Genome Diversity Center

at the Institute of Evolution, University of Haifa

(Since August 2000)
Head: Edward N. Trifonov




back to genom diversity center site

List of 14638 significant tripeptide signatures



Legend for the table columns:
1. The signature rank.
2. The signature name.
3. The consensus sequence derived for this signature.
4. Number of hits for this signature in the proteome database.
5. Number of hits that were homologous to the consensus sequence.
6. percentage of consensus homologous hits.


1. 2. 3. 4. 5. 6.
1 SGG-24-SAL SGGQRQRVAIARALAMNPKILLLDEPTSAL 1427 1364 96%
2 LSG-25-SAL LSGGQQQRVAIARALAMDPKILLLDEPTSAL 1092 1043 96%
3 SGG-26-LDV SGGQRQRVMIARALALEPKLLIADEPTSALDV 859 784 91%
4 SGG-26-LDA SGGQRQRVAIARALVREPKVLLLDEPLSNLDA 728 699 96%
5 LSG-27-LDA LSGGQRQRVAIARALVREPKVLLLDEPLSNLDA 645 619 96%
6 SGG-25-GLD SGGMKRRVAIARALALDPKLLILDEPTSGLD 473 402 85%
7 LSG-27-LDV LSGGQRQRVAIARALACEPDLLIADEPTTALDV 480 438 91%
8 SGG-24-GAL SGGQQQRVAIARALANEPKVLLLDEPTGAL 416 394 95%
9 SGG-26-LDI SGGEKQRLALARALLQEPNLLLLDEPTNHLDI 370 308 83%
10 LSG-25-GAL LSGGQQQRVAIARALANEPKVLLLDEPTGAL 370 336 91%
11 SGG-26-LDL SGGQKQRVALARALLQEPNLLLLDEPTNHLDL 320 297 93%
12 LSG-27-LDI LSGGERQRVALARALAQDPNVLLLDEPTNHLDI 296 269 91%
13 LSG-26-GLD LSGGQKRRVAIARALALDPDLLILDEPTTGLD 299 255 85%
14 GIG-27-GLG GIGIPEEDQERIFERFYQADSSRSRRYGGTGLG 286 227 79%
15 GIG-28-LGL GIGIPEEDQERIFERFYQVDSSRSRRYGGTGLGL 281 240 85%
16 LSG-27-LDL LSGGQKQRVALARALLQEPNVLLLDEPTNHLDL 244 214 88%
17 AIA-25-EVL AIARALAMDPKVMLFDEPTSALDPEMVGEVL 229 199 87%
18 SGG-25-GID SGGNQQKVLIARWLATEPKVLILDEPTRGID 201 177 88%
19 GIG-26-TGL GIGIPEEDQERLFEPFYQADSSRSRRYGGTGL 204 169 83%
20 GGG-24-LGG GGGTFDVSILELGDGVFEVLATAGDNALGG 229 111 48%
21 VAI-26-EVL VAIARALAMDPKVMLFDEPTSALDPEMVGEVL 195 177 91%
22 LDV-28-GVV LDVTIQAQILDLLKELQEEFGMAIIFITHDLGVV 182 168 92%
23 SGG-28-AKL SGGQRQRVAMGRAIVRDPKVFLMDEPLSNLDAKL 180 171 95%
24 LAL-25-LAE LALNAAIEAARAGEAGRGFAVVADEVRKLAE 247 144 58%
25 LSG-26-GID LSGGNQQKVIIARWLATEPKVLILDEPTRGID 181 156 86%
26 LSG-29-AKL LSGGQRQRVAMGRAIVRDPKVFLMDEPLSNLDAKL 175 158 90%
27 VIG-27-VGK VIGRDEEIRRVIQVLSRRTKNNPVLIGEPGVGK 164 152 93%
28 VIG-26-GVG VIGRDEEIRRVIQVLSRRTKNNPVLIGEPGVG 172 152 88%
29 SGG-28-VSV SGGQRQRIAIARALALKPELLIADEPTSALDVSV 162 151 93%
30 ALN-24-LAE ALNAAIEAARAGEAGRGFAVVADEVRKLAE 173 143 83%
31 LDV-27-LGV LDVTIQAQILDLLKDLQEEFGTAIIFITHDLGV 163 140 86%
32 SGG-24-AAL SGGQRQRVAIARALLKDPKLLLLDEPTAAL 189 164 87%
33 LGG-25-LGG LGGGTFDVSILELGDGVFEVLATAGDNHLGG 183 108 59%
34 ELL-28-ALA ELLALVGLADKADRYPAQLSGGQQQRVAIARALA 210 125 60%
35 LLA-26-LAE LLALNAAIEAARAGEHGRGFAVVADEVRKLAE 223 127 57%
36 SGG-24-ASL SGGQKQRVAIARALLQDPKILLADEPTASL 155 144 93%
37 SGG-24-SGL SGGEKKRNEILQALLLEPKLAILDEPDSGL 150 101 67%
38 NLL-26-KLA NLLALNAAIEAARAGEHGRGFAVVADEVRKLA 143 129 90%
39 LDA-29-EAL LDAKLRKELREELRELHKELGITTIFVTHDQEEAL 166 108 65%
40 LSG-25-AAL LSGGQRQRVAIARALLKEPKLLLLDEPTAAL 197 145 74%
41 LLA-25-KLA LLALNAAIEAARAGEHGRGFAVVADEVRKLA 166 121 73%
42 SGG-24-TGL SGGMKRRVALARALAADPDVLFLDEPTTGL 140 103 74%
43 LSG-25-ASL LSGGQKQRVAIARALLQDPKIILADEPTASL 159 121 76%
44 NLL-27-LAE NLLALNAAIEAARAGEAGRGFAVVADEVRKLAE 146 130 89%
45 GAG-25-GVG GAGVGKTVLIMELINNIAGEHGGYSVFAGVG 176 89 51%
46 GIG-29-GLA GIGIAPEDLERLFERFYQVDSSRTRKYGGTGLGLA 155 127 82%
47 LLD-25-GIT LLDEPLSALDAKLREEMQYELKRLQRKLGIT 135 98 73%
48 LSG-24-LSA LSGGQKQRVAIARALVNNPEVLLLDEPLSA 155 123 79%
49 LAL-24-KLA LALNAAIEAARAGEHGRGFAVVADEVRKLA 152 121 80%
50 ILD-28-VIA ILDEATSALDTETERLIQKALDELMKGRTSFVIA 127 110 87%
51 ELL-24-AIA ELLEKVGLADKADAYPAQLSGGQQQRVAIA 156 108 69%
52 SGG-26-IGL SGGEAQRIRLATQIGSGLTGVLYVLDEPSIGL 130 104 80%
53 ALA-24-ELL ALAAAPEILLLDEPTSALDPAAQLLILELL 183 52 28%
54 TLL-25-GVG TLLAKAVAGEAGVPFFSISGSDFVEMFVGVG 131 98 75%
55 LAL-25-LAS LALNAAIEAARAGEQGRGFAVVADEVRSLAS 177 91 51%
56 LAL-24-SLA LALNAAIEAARAGEQGRGFAVVADEVRSLA 173 85 49%
57 RIL-28-GIT RILFYTGKIHKIGEVHDGAATMDWMEQEQERGIT 114 100 88%
58 LLG-24-GLL LLGTFALLLGGGLAGNTLTMAAMVLAIGLL 190 26 14%
59 LDV-26-DLA LDVSIQAQILNLLKELQRELGLALLFITHDLA 120 93 78%
60 LVG-24-ALA LVGLADKADAYPSQLSGGQKQRVAIARALA 181 91 50%
61 LSG-27-IGL LSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGL 128 99 77%
62 LSG-25-TGL LSGGQKRRVALARALAADPDILILDEPTTGL 129 84 65%
63 ALN-24-LAS ALNAAIEAARAGEQGRGFAVVADEVRSLAS 122 91 75%
64 TLG-27-IEL TLGPKGRNVVLDKSFGAPTITKDGVTVAKEIEL 110 96 87%
65 IGG-29-IGG IGGDPIVGLNFIDALKLFEEDPETEAIVMIGEIGG 128 73 57%
66 GEI-26-GEI GEIHGLLGENGAGKSTLMRAIAGLLKPDSGEI 111 92 83%
67 GAS-29-GAG GASRVRDMFEQAKKNAPCIIFIDEIDAVGRQRGAG 131 73 56%
68 LFG-28-GVG LFGGAGVGKTVLIQELINNIAKEHGGYSVFAGVG 112 88 79%
69 GVS-28-LGY GVSPATVSRVLNGKPGVSEETRARVLAAIEELGY 107 89 83%
70 GAG-26-LSG GAGGAGGLPVAAGAPTEVPVNGVSLTGQYLSG 137 82 60%
71 LLA-24-GVG LLAKAVAGEAGVPFFSISGSDFVEMFVGVG 146 98 67%
72 GLS-28-RLL GLSPAISIDQKTTSHNPRSTVGTVTEIYDYLRLL 127 86 68%
73 AIA-26-VLD AIARALAMKPKIMLFDEPTSALDPEMVKEVLD 120 90 75%
74 TGL-28-LDV TGLHFDDIAKLLKVLHRLVDKGNTVVVIEHNLDV 106 76 72%
75 GIA-26-LGL GIAPEHLPRIFERFYQADGSRSRRYGGTGLGL 141 86 61%
76 TLL-27-GAS TLLAKAVAGEAGVPFFSISGSDFVEMFVGVGAS 115 88 77%
77 GDL-29-AAL GDLYVVIHVKPHPIFERDGDDLYCEVPISFAQAAL 131 88 67%
78 SGG-29-ELV SGGQQQRVAIARALAMEPEVMLFDEPTSALDPELV 110 98 89%
79 VGL-24-ALA VGLSPDHAARYPHEFSGGQRQRIGIARALA 176 109 62%
80 GIA-25-GLG GIAPEHLPRIFERFYQVDGSRTRRYGGTGLG 127 82 65%
81 LSG-28-DAL LSGGQKQRVALARALVHEPRLLLLDEPLGALDAL 124 78 63%
82 SLG-25-GLD SLGMKQRLGIAAALLHNPKLLILDEPTNGLD 108 89 82%
83 LLA-26-GAS LLAKAVAGEAGVPFFSISGSDFVEMFVGVGAS 134 88 66%
84 LLG-28-ALE LLGKRVDYSGRSVIVVGPYLKLHQCGLPKKMALE 130 76 58%
85 GDL-28-GEI GDLARWLPDGNLEYLGRIDHQVKIRGFRIELGEI 103 87 84%
86 LLE-27-ALA LLELVGLADKADAYPAQLSGGQQQRVAIARALA 159 103 65%
87 ALA-25-LLK ALALEPKLLICDEPTSALDVSVQAQILELLK 138 82 59%
88 LLL-26-GIT LLLDEPLSALDAKLRKQMQEELKRLQRKLGIT 119 84 71%
89 GVL-26-ISG GVLLVGPPGTGKTLLAKAVAGEAGVPFFSISG 106 84 79%
90 VAI-27-VLD VAIARALAMDPKVMLFDEPTSALDPEMVKEVLD 102 82 80%
91 SGG-27-DAL SGGMKQRVAIARALAHEPKLLLLDEPFGALDAL 110 88 80%
92 AEI-24-SGG AEIDRRVAEALKLVQLEHLLDRKPAQLSGG 100 72 72%
93 GLF-29-GVG GLFGGAGVGKTVLIMELINNIAKEHGGYSVFAGVG 99 86 87%
94 LAL-24-ALA LALNAAIEAARAGEAGRGFAVVADEVRALA 272 83 31%
95 GDL-26-ELG GDLARWLPDGTLEYLGRIDHQVKIRGFRIELG 100 84 84%
96 VLL-27-GIT VLLLDEPLSALDAKLREQMQVELKRLQRELGIT 102 64 63%
97 AKL-25-DAL AKLAGGVAVIKVGAATEVEMKEKKDRVEDAL 106 92 87%
98 GIV-29-GAL GIVHALGPEQGLTLPGMTIVCGDSHTNTHGAFGAL 110 38 35%
99 LIG-26-LLD LIGAPPGYVGYDEGGLLTEAVRRKPYSVLLLD 107 78 73%
100 NLL-27-LAS NLLALNAAIEAARAGEQGRGFAVVADEVRSLAS 108 72 67%
101 GVG-24-GGI GVGVPQITAIADAAEAAREYGIPVIADGGI 101 68 67%
102 LLA-25-SLA LLALNAAIEAARAGEQGRGFAVVADEVRSLA 159 67 42%
103 DLA-27-GEI DLARALADGSSEYDGRLDHQVKIRGERIELGEI 97 40 41%
104 SGG-24-AGL SGGQKRRVAIAGALAMDPKVLVLDEPTAGL 113 84 74%
105 GDL-25-IEL GDLARWLPDGTLEYLGRIDHQVKIRGFRIEL 91 85 93%
106 NLL-29-ALE NLLGKRVDYSGRSVIVVGPYLKLHQCGLPKKMALE 102 76 75%
107 LLG-29-LEL LLGKRVDYSGRSVIVVGPYLKLHQCGLPKKMALEL 113 76 67%
108 LLL-25-LGI LLLDEPLSALDAKLRKQMQAELKALQRKLGI 146 57 39%
109 LGA-28-ALG LGAGRGQAFRIVVLPLALPGILAGFILGLARALG 149 44 30%
110 GGG-26-IAA GGGHDEREQTLNQLLVEMDGFEGNEGIIVIAA 119 75 63%
111 ALA-24-DLL ALAAEPEILLADEPTSALDVATQAQILDLL 147 58 39%
112 ADL-27-LAT ADLMMVAPKTVELAIARLAQKARAAGIHLVLAT 102 45 44%
113 LAL-24-NLA LALNAAIEAARAGEQGRGFAVVADEVRNLA 106 70 66%
114 EVL-24-TLL EVLKGIDLEIEKGEVVAIIGPSGSGKSTLL 100 76 76%
115 ILL-26-LVE ILLSRQVGVPYIVVFLNKCDMVDDEELLELVE 100 82 82%
116 SGG-25-GLA SGGEQQMLAIGRALMSRPKLLLLDEPSLGLA 107 85 79%
117 DVL-26-GFL DVLVGINLLREGLDIPEVSLVAILDADKEGFL 87 71 82%
118 EVI-29-NAL EVIMTVLHAGGKFDQNSYKVSGGLHGVGVSVVNAL 89 79 89%
119 EVI-26-SVV EVIMTVLHAGGKFDQNSYKVSGGLHGVGVSVV 85 78 92%
120 ILL-25-ELV ILLSRQVGVPYIVVFLNKCDMVDDEELLELV 96 80 83%
121 GSG-27-GSG GSGGGGSGGNGSGSGGGGGSGSGSGGGGGNGSG 156 117 75%
122 GLA-29-VLL GLADKIKAAPRQLSGGQAQRVAIARALAREPPVLL 136 38 28%
123 GIA-28-NLL GIARALALEPKLIICDEPVSALDVSIQAQVLNLL 89 73 82%
124 LVE-24-ALL LVEMDGFEGNEGIILIAATNRPDVLDPALL 121 74 61%
125 GSI-29-VLS GSITSFQAVYVPADDLTDPIPDTTFAHLDGTIVLS 93 73 78%
126 LPL-26-ALG LPLRGKILNVEKARFDKMLSSQEVGTLITALG 126 62 49%
127 LLG-28-TLA LLGVTGSGKTFTIANVIAQVQRPTLVLAHNKTLA 129 78 60%
128 LAL-24-TLA LALNAAIEAARAGEQGRGFAVVADEVRTLA 145 77 53%
129 ELV-24-ALK ELVEMEVRDLLSEYDFPGDDTPIIRGSALK 94 52 55%
130 GIG-28-GEI GIGGDPIPGTNFIDVLKLFEEDPETEAIVMIGEI 91 73 80%
131 LLD-24-LGI LLDEPLSALDLKLRKQMQYELKELQRKLGI 101 72 71%
132 GVG-28-LDL GVGKTAIVEGLAQRIVAGDVPESLKDKRLYSLDL 92 72 78%
133 TGL-29-DVI TGLHFDDIAKLLKVLHRLVDKGNTVVVIEHNLDVI 82 74 90%
134 LDV-27-LSV LDVSVQAQVLNLLKDLQEELGLTYLFISHDLSV 85 64 75%
135 GIG-29-GLS GIGIPKEDQERIFERFYQVDKSRSRKYGGTGLGLS 94 74 79%
136 LVE-26-ALE LVEMEVRELLSEYDFPGDDTPIIRGSALKALE 106 73 69%
137 NLL-26-SLA NLLALNAAIEAARAGEQGRGFAVVADEVRSLA 91 67 74%
138 LVE-25-LLR LVEMDGFEGNEGIIVIAATNRPDVLDPALLR 101 74 73%
139 LEL-24-SAL LELVEMEVRELLSEYDFPGDDTPIIKGSAL 100 70 70%
140 LVV-28-EAL LVVDDEPDIRKLLKTNLEKEGYEVITAADGEEAL 105 59 56%
141 LLL-27-VVS LLLDEPTNHLDLQAIQWLEEFLIDFEGTVIVVS 109 56 51%
142 AIV-25-TGL AIVWQSRRTADICEQLKEDGYEDYIREKTGL 90 56 62%
143 LNA-29-LGL LNALSGKGVHVVTVNDYLAKRDAEEMGPLYEFLGL 96 74 77%
144 ELI-29-AIG ELIIGDRQTGKTAVAIDTIINQKGQGVICIYVAIG 88 61 69%
145 AGL-25-ALA AGLADPNRPIGSFLFLGPTGVGKTELAKALA 202 63 31%
146 IVV-29-AGI IVVIVDELADLMMVAGKKVEEAIARLAQMARAAGI 87 53 61%
147 GVV-26-VVL GVVGQIIPWNFPLLMAAWKLAPALAAGNCVVL 102 70 69%
148 LLV-25-ALL LLVEMDGFGANEGIILIAATNRPDVLDPALL 175 55 31%
149 GAI-29-VFL GAILVVSAADGPMPQTREHILLARQVGVPYIVVFL 81 56 69%
150 IDL-28-SVV IDLGTTNSCVAVLEGGEPKVIANPEGRRTTPSVV 82 67 82%
151 LLG-28-GSI LLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSI 94 60 64%
152 LLA-25-ALA LLALNAAIEAARAGEAGRGFAVVADEVRALA 260 72 28%
153 RLL-25-ALE RLLPVLCQAHGLTPEQVVAIASNGGGKQALE 111 56 50%
154 GLI-29-NAL GLIPEFIGRLPVVATLEELDEEALIQILTEPKNAL 86 60 70%
155 VLL-25-ISG VLLVGPPGTGKTLLAKAVAGEAGVPFFSISG 92 67 73%
156 SAL-29-LSV SALDVSVQAQVLNLLMDLQEELGLTYLFISHDLSV 96 66 69%
157 ILL-24-LEL ILLSRQVGVPYIVVFLNKCDMVDDEELLEL 93 74 80%
158 ELL-26-SAL ELLELVEMEVRELLSEYDFPGDDLPIIRGSAL 112 65 58%
159 VGL-25-IGS VGLDYLTLSRAAGTLSGGEAQRIRLATQIGS 90 66 73%
160 LNA-28-FLG LNALSGKGVHVVTVNDYLARRDAEWMGPLYEFLG 79 61 77%
161 VGK-27-LDL VGKTAIVEGLAQRIVNGDVPESLKDKRLYSLDL 79 72 91%
162 LGL-26-LTL LGLLIIDEEQRFGVRHKERLKALKANVDVLTL 125 63 50%
163 AGL-26-LPL AGLQAIPKDLYEAARIDGASAWQVFRKITLPL 118 42 36%
164 SGG-25-GLL SGGVDSSVVAVLLHKAIGDQLTCVFVDHGLL 97 72 74%
165 AIA-29-GVG AIALRNRWRRMQLVPELRTEIGPKNILMIGPTGVG 98 42 43%
166 GKL-26-LIG GKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIG 84 65 77%
167 GLG-28-DLA GLGKTTLANIIANEMGVNLRTTSGPVLEKAGDLA 93 66 71%
168 LAK-26-DAL LAKLAGGVAVIKVGAATEVELKEKKDRIEDAL 96 61 64%
169 IVV-27-IGS IVVLNAGRIEQVGTPLELYHRPANLFVAGFIGS 77 60 78%
170 GLG-27-GDL GLGKTTLANIIANEMGVNLRTTSGPVIEKAGDL 88 73 83%
171 VIG-25-IGS VIGQDEAVEAVAKAIRRNRAGLKDPNRPIGS 84 68 81%
172 LLE-29-ALE LLELVEMEVRELLSEYDFPGDDTPIIRGSALKALE 111 60 54%
173 LVG-25-LDG LVGESGSGKSTLLRLIARLYEPTSGRILLDG 87 62 71%
174 LLA-26-LAS LLALNAAIEAARAGEQGRGFAVVADEVRSLAS 142 70 49%
175 GAL-27-LLA GALLVGLLGARLLLLAVGVAALAVVAMALLLLA 175 18 10%
176 LPL-24-ITA LPLRGKILNVEKARFDKMLSSQEVGTLITA 82 64 78%
177 IGL-29-LGA IGLAAIALALGAGALRIIAEDISEEKLEAARALGA 108 32 30%
178 ELV-27-ALE ELVEMEVRELLSEYDFPGDDTPIIRGSALKALE 92 70 76%
179 IGG-27-GEI IGGDPIPGTNFIDVLKLFEEDPETEAIVMIGEI 78 73 94%
180 LPL-29-GLG LPLALPTIMAGINQTLMLALSMVVIASMIGAGGLG 95 59 62%
181 IEA-27-LSG IEAAKGAGAHEFIQTLPDGYDTNYGERGAKLSG 83 32 39%
182 ALS-28-LDA ALSGGQRQRVALGRAIVREPKVFLLDEPLSNLDA 100 72 72%
183 GLG-29-LAA GLGKTTLANIIANEMGVNLRTTSGPVLEKAGDLAA 139 58 42%
184 LVG-25-LGG LVGPPGVGKTSLGQSIAKATGRKFVRMALGG 101 51 50%
185 TGL-28-LDL TGLPNRRLFLERLDQALLRAQRSGSPLALLFLDL 86 35 41%
186 ALA-24-NLL ALALEPELIIADEPVSALDVSVQAQILNLL 103 64 62%
187 AIA-28-ELL AIARALALDPKLLLADEPTSALDPATARQILELL 109 67 61%
188 AVL-27-ADL AVLERHGGLKLADQDVFLNVVGGLKVTETAADL 103 34 33%
189 LGA-25-LGG LGANAILGVSLAVARAAADALGLPLYRYLGG 121 54 45%
190 IAD-29-LLI IADEPTTALDVTIQAQILELLTELQQESNTAILLI 80 55 69%
191 GID-29-SVV GIDLGTTNSCVAVLEGGEPKVIANPEGNRTTPSVV 74 69 93%
193 LLA-28-ALG LLARLGAALVLLLGALAAGLRRTLLSLLLLIALG 172 15 9%
194 AIS-24-RLL AISIEQKTTSHNPRSTVGTVTEIYDYLRLL 89 70 79%
195 LIV-29-LLI LIVAPPKAGKTMLLQNIAQSITTNHPECVLIVLLI 97 52 54%
196 VID-26-ELI VIDLLCPYAKGGKVGLFGGAGVGKTVNMMELI 78 58 74%
197 LLF-29-TLA LLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA 87 56 64%
198 LSG-26-GLL LSGGVDSSVVAVLLHRAIGDQLTCVFVDHGLL 111 61 55%
199 GAG-25-IGG GAGPAGLAAADVLARRGHKVTVFDRHPEIGG 109 58 53%
200 GGS-27-GFL GGSIRIHQREMQEKVFEALGITEEEAQEKFGFL 73 64 88%
201 LGT-26-SVV LGTTNSCVAVLEGGEPKVIANAEGNRTTPSVV 81 61 75%
202 RLI-27-LLD RLIGAPPGYVGYDEGGLLTEAVRKKPYSVLLLD 84 65 77%
203 IAS-29-VAI IASNIGGKQALETVQRLLPVLCQAHGLTPEQVVAI 81 57 70%
204 NLL-26-ALA NLLALNAAIEAARAGEAGRGFAVVADEVRALA 104 71 68%
205 IDL-25-AGL IDLDIKDGEFVVLVGPSGCGKSTLLRLIAGL 86 69 80%
206 ALA-28-ALL ALALAGLSAADVDAVEAHGTGTTLGDPIEAQALL 242 38 16%
207 LGL-29-LLR LGLSGGVDSSVVAPLLHRAIGDLLTCVFVDNGLLR 117 38 32%
208 GLS-26-SAL GLSGGQQQRLCIARALAVEPEVLLLDEPTSAL 100 70 70%
209 LDV-28-SVV LDVSVQAQVLNLLKDLQEELGLTYLFISHDLSVV 72 65 90%
210 VLV-24-LNA VLVGTVSIEKSELLSKLLKKAGIPHNVLNA 77 57 74%
211 AIL-26-ITA AILPLKGKILNVEKARFDKMLSSQEVATLITA 79 58 73%
212 GGS-28-FLL GGSIRIHRREMQEKVFEILGITEEEAQEKFGFLL 72 60 83%
213 LGL-24-DVL LGLLIIDEEQRFGVKHKEKLKELKTNVDVL 92 50 54%
214 LEA-27-LGL LEARLLMMSTNNILSPANGEPIIVPSQDVVLGL 101 34 34%
215 LAA-24-LLE LAAESHVDRSIDGPAAFIETNIVGTLRLLE 131 21 16%
216 GGG-28-GFL GGGSIRIHQKEMQEKVFEALGITEEEAQEKFGFL 79 65 82%
217 GDL-27-ITA GDLGVEIPDEEVPGLQKKLIRRARRLNKPVITA 72 67 93%
218 ILV-27-VFL ILVVSAADGPMPQTREHILLARQVGVPYIVVFL 76 64 84%
219 SGG-26-LLR SGGVDSSVVAVLLHKAIGDQLTCVFVDHGLLR 84 72 86%
220 GGG-24-IVA GGGAFSGKDPSKVDRSAAYAARYVAKNIVA 83 56 67%
221 PLL-29-LLG PLLEVRGVTKSYGGLIALDGVDLTIVPGEIHALLG 113 40 35%
222 ELI-28-VAI ELIIGDRQTGKTAVAIDTIINQKDQGVICIYVAI 74 60 81%
223 LVD-29-GIT LVDKLLKQSGTFRENEEVAERVMDSNDLEKERGIT 73 64 88%
224 GGS-28-SGG GGSMGSVVGEKIVRAVEAALEDGCPLIGFSASGG 101 47 47%
225 LEA-29-GSG LEAMLIVADKKASLIITGNGDVIEPEDGLIAIGSG 80 52 65%
226 GVV-24-LGV GVVSRIVPVEDMPYLADGTPVDIVLNPLGV 93 34 37%
227 LDA-28-IEA LDAKLRVDMRAEIKRLHQRLKTTTVYVTHDQIEA 79 46 58%
228 GGG-27-GGI GGGATKERVAEAFKIILSDPNVKGVLVNIFGGI 86 60 70%
229 AGL-26-EAL AGLDYPGVGPEHAYLNDIGRAEYVSITDDEAL 116 56 48%
230 TLA-29-GIT TLADRILELTGTLSAREMKAQVLDSMDLERERGIT 85 63 74%
231 GGG-26-GGS GGGTGLGVALSALRGSGADITAIVTVADDGGS 114 41 36%
232 GLI-29-LLG GLIKANIPTRIAFTVSSKIDSRTILDQGGAEKLLG 106 53 50%
233 SGG-28-ALT SGGMKQRVAIARALAHEPKLLLLDEPFGALDALT 84 65 77%
234 LLE-27-ALL LLELVGLLSKLAEAAALLSAGLLQRLGQARALL 122 13 11%
235 LSG-24-LGA LSGGQQQRVALARALVNRPRVLLLDEPLGA 102 67 66%
236 EAL-24-LIV EALLRWQHPERGLISPDEFIPLAEETGLIV 83 51 61%
237 LIG-29-DAI LIGTFAVMYLSGFSINLLTLLALVLAIGLVVDDAI 74 50 68%
238 LAT-28-GAI LATLLARKKFTKAEREAGKAALVLGLCGITEGAI 80 43 54%
239 GLF-29-EAL GLFGTVWGIMNSFIGIALSKQTTLAVVAPGIAEAL 78 52 67%
240 AGL-27-PLL AGLQAIPKSLYEAALIDGASGWQRFRFITLPLL 103 50 49%
241 LEL-29-ALA LELLELVGLADRALAYPANLSGGQQQRVAIARALA 110 30 27%
242 AVL-28-DLA AVLEKRGGLLLQDQDVYLNVAGGVKVTEPAADLA 96 49 51%
243 LVF-29-LGG LVFDLGGGTFDVSILELGDGVFEVLATAGDNKLGG 77 43 56%
244 LSG-25-AGL LSGGQMRRVAIAGALAMEPEVLVLDEPTAGL 110 69 63%
245 GIS-25-GLG GISEEDQERIFERFYRADKSRSRQYGGTGLG 80 57 71%
246 LVV-24-IVV LVVSAADGPMPQTREHILLARQVGVPPIVV 82 46 56%
247 LLG-25-LDG LLGPSGAGKSTLLRMLAGFEEPSSGRILLDG 89 63 71%
248 LSG-29-VSV LSGGQRQRVAIARALALRPELLIADEPTSALDVSV 78 51 65%
249 LGV-25-ITA LGVEIPDEEVPGVQKKLIRKANRLGKPVITA 78 56 72%
250 LEL-28-ALE LELVEMEVRELLSEYDFPGDDTPIIRGSALKALE 90 64 71%
251 LLT-28-LLA LLTALDSALARILGLELGADDYLLKPFGIAELLA 141 31 22%
252 GIA-27-GLA GIAPEHLPRLFERFYRADSSRSRQTGGTGLGLA 105 63 60%
253 VGL-24-ALI VGLLPEHANRYPHEFSGGQRQRIAIARALI 95 55 58%
254 VLD-28-IVV VLDEPSIGLHQRDNERLIETLKHLRDLGNTVIVV 72 56 78%
255 GGG-27-LSG GGGMPVGAFGGRREIMDAIAPTGPVYQAGTLSG 89 49 55%
256 AIA-28-DLL AIARALALEPEVLLLDEPTSALDPSVQAQILDLL 90 54 60%
257 LVG-24-GFL LVGINLLREGLDIPEVSLVAILDADKEGFL 80 60 75%
258 KLA-24-DAL KLAGGVAVIKVGAATEVELKEKKDRVEDAL 81 63 78%
259 EGL-25-LVA EGLAQRIVNGEVPEGLKDKRVLSLDLGALVA 83 49 59%
260 GIG-25-GSG GIGIPKEDLERIFERFFQVDSSRNRKYGGSG 80 32 40%
261 IGA-25-LLD IGAPPGYVGYDEGGLLTEAVRRKPYSVLLLD 81 60 74%
262 ALA-24-IEA ALANAGLSAADVDAVEAHGTGTTLGDPIEA 102 46 45%
263 ILD-29-VIE ILDEPTTGLHFDDIAKLLDVLHRLVDQGNTVVVIE 69 60 87%
264 ALA-26-AGL ALAAGNAVVLKPAELTPLSALALAELAAEAGL 191 60 31%
265 LLD-26-VVS LLDEPTNHLDLDSIQWLEEFLIDFEGTVIVVS 80 55 69%
266 GLA-24-LVA GLAQRIVNGDVPEGLKDKRVLSLDLGALVA 123 48 39%
267 VLL-26-LGI VLLLDEPLSALDAKLRLDLQAELKALQAELGI 111 40 36%
268 GID-28-ISA GIDKAVAAAVEELKKLSKPCSDSKEIAQVGTISA 69 63 91%
269 IAL-28-GVG IALRNRWRRMQLVEELRHEVTPKNILMIGPTGVG 82 42 51%
270 LLK-26-EIA LLKKAAGIEKGSGEPNKTKVATVTRAQVQEIA 80 41 51%
271 AIA-29-LLR AIARALALEPKLILLDEPTSALDPSVQAQVVELLR 93 47 51%
272 LAA-25-LEA LAAQSHVDRSIEGPAATAETNIVGTLNLLEA 124 45 36%
273 LLE-25-SAL LLELVEMEVRELLSEYDFPGDDTPIIKGSAL 92 67 73%
274 GAG-25-LGG GAGPAGYSAAGRLADLGGGGTLVEAVGSLGG 111 24 22%
275 LVV-26-VFL LVVSAADGPMPQTREHILLARQVGVPYIVVFL 73 51 70%
276 IDL-25-ELI IDLLCPFAKGGKVGLFGGAGVGKTVLMMELI 71 58 82%
277 LLK-27-ALA LLKPVLLEGELDCYPATLSGGQRQRVAIARALA 100 29 29%
278 GLL-25-LTL GLLIIDEEQRFGVRHKERIKLLKANVDVLTL 105 44 42%
279 ALL-24-AIA ALLAAVGLADKADAYPAQLSGGQQQRVAIA 137 39 28%
280 GIA-28-LAI GIAPEHLPRLFERFYRVDKARSRQTGGTGLGLAI 80 55 69%
281 IVA-28-LLI IVAPPKAGKTMLLQNIAQSITYNHPECVLIVLLI 81 49 60%
282 GIS-26-LGL GISEEDQPRIFERFYQADKSRSRQYGGTGLGL 86 60 70%
283 AIL-28-ALG AILPLRGKILNVEKARFDKMLSSQEVATLITALG 101 59 58%
284 AAI-27-GIT AAITTVLAKKGGAEARAYDQIDNAPEEKARGIT 77 65 84%
285 LDA-26-LDG LDATTGQNALSQAKAFKEVVGVTGIVLTKLDG 82 49 60%
286 ALV-25-ALA ALVELLAAAARLPGGLAGGQPARVALAAALA 177 14 8%
287 GGG-29-FLL GGGSIRIHQREMQEKVFKALGITEEEAQEKFGFLL 70 60 86%
288 DLI-29-AIA DLIEGNEAFAAQAILVFTPLKADELVVNVLGGAIA 78 58 74%
289 LAI-25-LTG LAISLATNSINVISADEAAEIVKAAPSLLTG 82 17 21%
290 GLA-29-GLF GLASPEKIRSWSFGEVKKPETINYRTLKPEKDGLF 83 37 45%
291 DLV-25-LVG DLVERTIEPKKQALIDAGLSVSDIDEVILVG 78 43 55%
292 LTG-29-LDL LTGLPNRRLFEERLEQALARAQRQGRPLAVLFLDL 80 45 56%
293 GGG-25-LLA GGGVIGDLAGFVAATYMRGVIFVQVPTTLLA 111 41 37%
294 EAI-25-GAL EAIARNLREMSDLKVPIICTVIGEGGSGGAL 77 50 65%
295 GLD-25-EAL GLDYPGVGPEHAYLNDIGRAEYVSITDDEAL 86 59 69%
296 SAL-28-DLA SALDVSVQAQVLNLLQDLQRELGLSYLFISHDLA 84 62 74%
297 LLD-28-VLL LLDEPLGALDALTRLEAQRLILALALRPGLAVLL 101 20 20%
298 ALK-24-LLR ALKNINLDIPKGEVTALIGPSGCGKSTLLR 79 45 57%
299 LVV-28-AIL LVVNKLRGGLKVAAVKAPGFGDRRKAMLEDIAIL 83 56 67%
300 NAL-28-LGL NALTGKGVHVVTVNDYLAKRDAEEMGPLYEFLGL 87 66 76%
301 ALV-24-AVL ALVDPSPLANPRRAAVGLDQNRLALLLAVL 125 43 34%
302 NAL-27-FLG NALTGKGVHVVTVNDYLARRDAEWMGPLYEFLG 65 57 88%
303 LAK-25-GAS LAKAIAGEAGVPFFSISGSDFVEMFVGVGAS 71 56 79%
304 LAE-26-IGA LAEAKVPYDIVLEMDDINEDFADTDVVLVIGA 82 32 39%
305 EGL-29-RLL EGLSPAISIDQKSTSHNPRSTVGTVTEIYDYLRLL 82 64 78%
306 IGA-25-LLR IGAEVRAGDILVGKVTPKGETQLTPEEKLLR 76 56 74%
307 GLG-29-LGA GLGHMAVKLAAALGAEVVAFTRSDRKAGAAPQLGA 115 38 33%
308 SAL-28-SVV SALRKVARVRLTNGIEVTAYIPGIGHNLQEHSVV 75 59 79%
309 GLG-24-LAI GLGLLVLLGIDRNDIGLGLVGGLALVILAI 118 37 31%
310 LDV-26-AGI LDVTDEDSVEAAAEAVVEGFGRLDILVNNAGI 72 32 44%
311 EGL-25-IVD EGLEAVRKRPGMYIGSTSGRGLHHLVWEIVD 65 52 80%
312 ATL-27-GAI ATLAALIGAGGEGREAGLGIDVMGLSLILEGAI 75 29 39%
313 ALG-28-ALG ALGEIKSEAAIPGLLNLLEDENWLVRGGAASALG 153 35 23%
314 VSL-24-IAG VSLLIKPGEFLALLGPSGCGKTTLLRLIAG 78 40 51%
315 EVL-25-LLR EVLKGINLEINKGEVVAIIGPSGSGKSTLLR 81 49 60%
316 GAL-26-LLI GALIIIEICLILEFYIETGIVLFALIGSELLI 93 33 35%
317 SAL-29-VVL SALRKVARVRLTNGIEVTAYIPGIGHNLQEHSVVL 89 51 57%
318 ALA-26-LVG ALAESLFGAADAMVRLDMSEYMEKHSVSRLVG 130 30 23%
319 LFG-28-EAL LFGTVWGIMNSFIAIAASKQTTLAVVAPGIAEAL 71 52 73%
320 LIV-24-LVA LIVADFIQWAKDNGIPVGPGRGSGAGSLVA 89 51 57%
321 AIA-27-LEL AIARALALLPALLLADEPTSALDAATTESILEL 81 34 42%
322 VDL-27-GGG VDLDGAKAGAKRNLPLIKKILAATKVPVQVGGG 71 40 56%
323 LAS-28-GLF LASPEKIRSWSFGEVKKPETINYRTLKPERDGLF 74 61 82%
324 VSL-25-AGL VSLAIAPGELVALLGPSGSGKSTLLRLIAGL 90 54 60%
325 GEI-26-GSI GEIVGIAGINGAGKSTLIRAITGLRKPDSGSI 62 54 87%
326 AIA-24-GAL AIARNLREMARLKVPIICTVIGEGGSGGAL 111 56 50%
327 LSG-25-SGL LSGGQRQRVAIARALLLDPDLLFLDEPTSGL 82 44 54%
328 LAL-24-ELA LALNAGVEAARAGEAGKGFAVVAQEVRELA 117 34 29%
329 LLR-28-NLL LLRDINKGTVDFFGNYDDVEREPVVLPARFPNLL 71 24 34%
330 LLA-24-ELL LLARLALKPSNLLVLDEPTNDLDVETLELL 124 26 21%
331 VVL-26-IGS VVLNAGRIEQVGTPLELYHRPANLFVAGFIGS 70 45 64%
332 VGL-25-LAL VGLSPDHAARYPHEFSGGQRQRIGIARALAL 115 59 51%
333 GGG-25-VIA GGGHDEREQTLNQLLVEMDGFEGNEGIIVIA 81 40 49%
334 ALE-27-AIV ALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIV 73 38 52%
335 GLD-28-RLL GLDIDALKVVSKGVNALRGEEFGALIITHYQRLL 78 42 54%
336 GAG-24-VLA GAGPGVGPVLAAQMGYLPGLLWLAAGVVLA 107 20 19%
337 LSG-29-ALT LSGGMKQRVAIARALAHRPRLLLLDEPFGALDALT 87 57 66%
338 LIV-28-VLL LIVAPPKAGKTMLLQNIAHSITYNHPECVLIVLL 90 49 54%
339 ILV-29-EAL ILVVDDEKDIRELLKKNLEKEGYEVDTASDGEEAL 71 47 66%
340 VGI-26-ALA VGIPDPERRLKSYPHELSGGMRQRVMIAMALA 94 60 64%
341 ALK-24-LLN ALKVVSKGINEGEFVAFGGPSGSGKQTLLN 71 47 66%
342 LLP-24-ALE LLPVLCQAHGLTPEQVVAIASNDGGKQALE 77 58 75%
343 GSI-24-LDG GSITAFYTVLVEGDDLQDPIADEARSILDG 62 50 81%
344 GVG-27-AEI GVGKTSLGQSIAKATGRKFVRMALGGVRDEAEI 64 54 84%
345 GFL-26-LLL GFLHDAGEFDAGFFGISPREALAMDPQQRLLL 88 46 52%
346 SGL-29-RLL SGLDIDALKVVSKGVNALRGEEFGALIITHYQRLL 79 42 53%
347 LVV-24-IVA LVVAADDGVMPQTIEAINHAKAAGVPIIVA 78 40 51%
348 LGT-25-LVD LGTFAVLAAFGFSINTLTMFGMVLAIGLLVD 64 35 55%
349 GLF-26-GIA GLFGTVWGIMNSFIGIAAAKQTTLAVVAPGIA 69 45 65%
350 GGG-27-AGL GGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGL 102 62 61%
351 EVI-24-LVE EVIASHFVLLNRAPTLHRLGIQAFAPRLVE 67 25 37%
352 VLE-27-VGL VLENITLAPVKVKGESKEEAEKKAMELLEKVGL 69 41 59%
353 GSG-27-LAE GSGKTVVAALAALAAITAGYQVALMAPTEILAE 81 47 58%
354 LSG-27-LLR LSGGVDSSVVAVLLHRAIGDQLTCVFVDHGLLR 86 61 71%
355 ALL-25-AIG ALLAVADKDLSLIILGNGDVVEPGADLVAIG 116 20 17%
356 LVG-25-IGG LVGPSGCGKSTLLRLIAGLERRSIGGILIGG 73 28 38%
357 IAL-27-TLL IALGGGVLLVLVGTAAALYFRGFPTILIPTTLL 89 39 44%
358 GSI-28-IVL GSITAFYTVLVEGDDQNDPIADLTRSILDGHIVL 67 40 60%
359 LEL-25-ALK LELVEMEVRDLLSEYDFPGDDTPVIRGSALK 76 46 61%
360 GID-25-GGG GIDPSVLDRIAQEIKELVELGVQVAVVIGGG 66 50 76%
361 LLV-29-LDG LLVLDATTGQNALNQAKVFNEALDITGVVLTKLDG 74 46 62%
362 ALE-26-VGL ALENVAMPLLIGGKPKAEARERAKELLEAVGL 80 44 55%
363 LEV-29-LGG LEVERIINEPTAAALAYGLDKTDGDEKILVYDLGG 70 48 69%
364 DLL-27-GSI DLLGRDPVEPDGELIAKYLTGKTVLVTGAGGSI 62 39 63%
365 GKL-25-VLI GKLDPVIGRDEEIRRTIQVLSRRTKNNPVLI 69 56 81%
366 ALS-28-LGL ALSLLLAAYAAEILRAGIKAVPVGQSEAARALGL 107 29 27%
367 VLG-28-LAI VLGVPVLSAALSGVDSLLSIVQMPLGIPVGTLAI 86 20 23%
368 GVG-25-IGL GVGKTTSSANIATGLALKGKKVLVIDFDIGL 71 31 44%
369 VGI-29-GEI VGIGGDPIPGTNFIDVLKMFEEDPETEAIVMIGEI 63 50 79%
370 LIG-25-LLL LIGAPPGYVGFDQGGLLTDAVEKFPHAVLLL 117 28 24%
371 LGF-25-DLI LGFGFRCGFLGLLHMEIIQERLEREFDLDLI 61 48 79%
372 VAL-24-LTG VALHYVYNTPFDQLIWDVGHQAYPHKILTG 90 33 37%
373 LVE-29-AVL LVEIQALVDPSLLGNPRRVAVGLDQNRLALLLAVL 81 40 49%
374 GGG-24-LGI GGGCELALACDIRIAAENAKFGLPEVKLGI 75 49 65%
375 GLS-27-LSG GLSKAEALARARELLELVGLEDFADRYPAQLSG 90 35 39%
376 GGG-28-GLA GGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLA 92 66 72%
377 VVS-25-GAG VVSAHRTPDLMFQYAEEARERGIKVIIAGAG 71 52 73%
378 GIS-27-GGS GISYTEFSYQILQGYDFAELNKEHGVTLQIGGS 63 42 67%
379 GLS-29-GLL GLSMALGAFLAGVLLAESEYRHELETAIEPFKGLL 97 27 28%
380 LAI-28-ALL LAIDRAKALFGADYANVQPHSGSQANQAVYLALL 117 40 34%
381 IAL-28-ALG IALALLAAAYASKTTRGALKAVPKGQREAAKALG 102 37 36%
382 LLD-25-LAK LLDEGRAGDNVGALLRGTKREEIERGQVLAK 85 43 51%
383 VIG-24-GGG VIGGPQGDCGLTGRKIIVDTYGGYARHGGG 74 65 88%
384 VLV-25-GFL VLVGINLLREGLDIPEVSLVAILDADKEGFL 68 57 84%
385 DVL-26-VGL DVLDMTVEEALEFFEAVPKIARKLQTLVDVGL 71 42 59%
386 VVL-28-LVD VVLLGTFGVLAAFGFSINTLTMFAMVLAIGLLVD 71 32 45%
387 EGL-24-EIV EGLEAVRKRPGMYIGSTDKRGLHHLVWEIV 67 52 78%
388 AIL-26-IVV AILVVSAADGPMPQTREHILLARQVGVPYIVV 68 44 65%
389 EGL-29-TLG EGLPAIVTVVLALGVQRMAKRNAIVRKLPAVETLG 63 46 73%
390 LGL-25-VLT LGLLIIDEEQRFGVKHKEKLKELKTNVDVLT 87 46 53%
391 VLD-27-LLF VLDEADRMLDMGFIDDIRKILAKLPAKRQTLLF 60 56 93%
392 GIA-27-GLL GIAEQIIARGVREGLSEEAARAGGFMVDRFGLL 86 17 20%
393 ALT-26-EGL ALTRVINDYARKNGLLKENKDNLTGDDIREGL 69 49 71%
394 TGL-25-LDG TGLSGSGKSTIANALEERLHALGVHTYLLDG 66 48 73%
395 LLG-24-ALL LLGLAALLLAALGLLSGGELLRLAIARALL 163 20 12%
396 LLT-28-ALG LLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALG 93 28 30%
397 SGG-24-GIG SGGALVNLNGELIGINTAILSPSGGNIGIG 73 55 75%
398 LLA-26-AIL LLATTLRGLTNDVYFQVGLLTTIGLSAKNAIL 109 29 27%
399 IVG-27-GLI IVGYAMGERMTKELTGKALFMALRSQRPPAGLI 73 36 49%
400 LAL-29-ALL LALAALLLLALLAGALLALLAALVELAVAAAAALL 196 2 1%
401 GSG-27-FLG GSGKSSLAFDTIYAEGQRRYVESLSAYARQFLG 61 53 87%
402 GAL-25-GAS GALALNGLLAAALPVNALYALLILAVLAGAS 83 12 14%
403 GVG-24-GLG GVGDTTTLVLAPLVAACGVPVAKMSGRGLG 90 39 43%
404 AGL-24-ITL AGLQAIPKDLYEAAAVDGASKWQQFFRITL 74 45 61%
405 LGA-28-AIG LGATGWQTFTKVVLPAALTGIVAGVVLGIARAIG 84 37 44%
406 VLE-27-IVD VLEGLEAVRKRPGMYIGSTDKRGLHHLVWEIVD 61 50 82%
407 VGK-26-AEI VGKTSLGQSIAKATGRKFVRMALGGVRDEAEI 57 54 95%
408 VIL-26-ALA VILFIDELHTLVGAGGAEGAMDAANILKPALA 94 38 40%
409 DLI-28-LEV DLISNEESRETFVTRSKIIRAIRRYLDGRGFLEV 60 43 72%
410 DLA-24-IEL DLARYRPDGTIEYLGRIDHQVKIRGFRIEL 64 37 58%
411 LVA-29-GLG LVADGSPFIPVIAKDKLYGIAPCLLAHILEGIGLG 94 29 31%
412 SGG-28-IAA SGGEEGALAGPSIMPGGQKEAYELVAPILEKIAA 78 37 47%
413 GLG-29-LLL GLGAALDALPAQLSGGQQQRVAIARALAAGPELLL 112 34 30%
414 ISA-28-EAL ISAGLDYPGVGPEHAYLNDIGRAEYVSITDIEAL 71 40 56%
415 VDL-25-AGL VDLSIADGEFVVLLGPSGCGKSTLLRLIAGL 74 39 53%
416 ITA-25-GGG ITASSEGRETILDVVERTAEQVFIPLTVGGG 68 42 62%
417 LAA-25-AGL LAAGNAVVLKPAEVTPLLALALAELALEAGL 178 35 20%
418 VEL-28-LTG VELTVALHYVFNTPKDRLIWDVGHQAYPHKILTG 65 55 85%
419 AIL-28-VFL AILVVSAADGPMPQTREHILLARQVGVPYIVVFL 67 56 84%
420 GDL-26-EVL GDLAAILTNLEPGDVLFIDEIHRLSPVVEEVL 66 41 62%
421 ATL-25-ALT ATLSQALIKPVAGENLILGIDRFMSDKRALT 79 28 35%
422 DLL-24-ELI DLLAPYAKGGKIGLFGGAGVGKTVLIQELI 66 53 80%
423 ALG-26-DLI ALGFGFRCGFLGLLHMEIIQERLEREFDLDLI 69 51 74%
424 GLS-28-LLR GLSGGVDSSVVAALLHRAIGDQLTCVFVDHGLLR 78 45 58%
425 LLA-26-LAL LLALLALLLLAALAALLAAALLGAALLALLAL 209 2 1%
426 AIA-25-DVL AIARALAMNPKVMLFDEPTSALDPELVGDVL 79 35 44%
427 AIA-26-VLN AIARALAMNPDVLLFDEPTSALDPEVVAEVLN 64 56 88%
428 LEA-25-TLA LEASVRYLAADLGPEGIRVNAISAGPIRTLA 77 31 40%
429 ELA-29-LAT ELADLMMVASKEVEDAIVRLGQKARAAGIHLILAT 77 27 35%
430 ALE-25-AEI ALEIADALVRSGAVDVIVVDSVAALTPKAEI 72 57 79%
431 SLG-28-FGL SLGSDTGGSIRQPAAFNGIVGLKPTGGRVSRFGL 63 14 22%
432 ITA-25-LDG ITATQMLESMITNPRPTRAEVMDVANAVLDG 59 46 78%
433 GLS-24-LDG GLSGSGKSTIAGALEEALFALGYHTYLLDG 65 45 69%
434 ALV-26-IGG ALVGALGGGPSTAAVAMTGEITLRGGVLPIGG 77 21 27%
435 VLD-27-VIV VLDEPSIGLHQRDNERLLGTLIHLRDLGNTVIV 59 37 63%
436 EAL-24-AIA EALRKVGLEGRAKRKPSELSGGQKQRVAIA 99 53 54%
437 LVE-24-LGA LVEGFPPSPAGTISVYGDSAPATLNDLLGA 73 14 19%
438 VAI-29-ELL VAIARALASNPKIILADEPTGALDPATTRSILELL 66 42 64%
439 GLG-26-ATL GLGAPYWDSYARGAIFGLTRGTSKEHFIRATL 90 42 47%
440 ELL-28-ALI ELLELVGLADRRDRIVGKLSGGMKQRLAIARALI 81 40 49%
441 EIA-29-SLG EIAQSEAATGKPFANYWMHNGFVNVDNEKMSKSLG 62 50 81%
442 GSG-24-AIT GSGKTRVLTHRIAYLIDEKGVNPWNILAIT 58 35 60%
443 ALA-25-LLA ALAARLALLLLAEATSALDPLLEAAGLALLA 228 13 6%
444 LAK-29-LIG LAKALAEDLFGSEDAMIRIDMSEYMEKHAVSKLIG 69 46 67%
445 GLS-28-SGG GLSKAEAEERAAELLELVGLKDFADRYPAQLSGG 74 43 58%
446 ILV-25-IVV ILVVSAADGPMPQTREHILLARQVGVPYIVV 61 46 75%
447 LIV-28-LSA LIVLTGLSGSGKSSLAFDTIYAEGQRRYVESLSA 70 36 51%
448 ALL-29-GSI ALLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSI 73 59 81%
449 AIA-28-NLL AIARALALEPKLLLLDEPTSALDVSVQAQILNLL 72 50 69%
450 GGG-24-TLL GGGVIGDLAGFAAATYQRGVRFIQIPTTLL 78 55 71%
451 SGG-27-SGG SGGGGGGGGGSGGGGGGGNGSGGGGGGGNGSGG 97 63 65%
452 LEA-25-EAI LEAYGAAYTLQEILTVKSDDVVGRVKTYEAI 71 38 54%
453 AIA-29-LLK AIARALASNPKVLLCDEPTSALDPATTAQILELLK 75 47 63%
454 IVA-29-LID IVAPPKAGKTVLLQNIAQSITYNHPECVLIVLLID 64 50 78%
455 AAL-29-AAL AALAAAAAAGLLTAALAGLGTALAAALAAALLAAL 260 8 3%
456 IAV-27-LAI IAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAI 70 36 51%
457 ATL-28-GKL ATLERLLSLLSAFEVVVWMTDGWPLYESRLKGKL 63 44 70%
458 IVG-25-AGI IVGIVGNTNVNQILYDGLTKLEYRGYDSAGI 70 53 76%
459 AIA-25-ALA AIARNLLEMAGLKVPVIATVIGEGGSGGALA 158 46 29%
460 IAV-29-LDA IAVASGKGGVGKSTTAVNLALALAAEGAKVGLLDA 66 43 65%
461 GIT-24-AAI GITKASLETDSFLSAASFQETTRVLTDAAI 66 44 67%
462 LSL-25-AGL LSLSVAAGEIVALLGPSGCGKTTLLALIAGL 97 26 27%
463 ALA-26-LLP ALAAGNCVVLKPAEATPASALVLLELIADLLP 123 28 23%
464 VIL-26-VIG VILRRTDDWMDGRRSRHTDDTDVLLRIHHVIG 66 21 32%
465 IAV-26-VLA IAVPVVLLGTFAVLAAFGFSINTLTMFGMVLA 81 36 44%
466 EAL-29-ALA EALAAAREIQDEADRADALASLAGKLPELLPEALA 143 22 15%
467 AAL-26-LGA AALLGAAAVIVAGAAALIRAALGAALMALLGA 152 1 1%
468 AIA-27-GVI AIAQVGTISANSDESIGLFIAEAMEKVGKEGVI 76 22 29%
469 GGG-26-GLG GGGVILAGASEELREFAEKLNLPVTSTLMGLG 94 42 45%
470 GIA-24-TGL GIAPEDLPRIFERFYQADGSTSRRYGGTGL 68 46 68%
471 LLG-29-LAA LLGVTGSGKTFTIANVIAQLQRPTLVLAPNKTLAA 159 61 38%
472 YGL-26-LVG YGLEKVKERILEYLAVQKRVNKLKGPILCLVG 59 42 71%
473 VIG-26-LVD VIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVD 62 30 48%
474 AKL-27-LNA AKLAGGVAVIKVGAATETELKEKKLRIEDALNA 60 30 50%
475 GLV-28-GKL GLVVPVLRDVDKKGIAEIEKEIAELAKKARDGKL 62 52 84%
476 GSG-24-LAA GSGKTFTIANVIAQLQRPTLVLAPNKTLAA 96 52 54%
477 VGK-26-GFL VGKSTTARLLQALLSRWPEHPKVELVTTDGFL 54 38 70%
478 GLA-28-GVG GLAVGEPHEEMNRVLDHTCPQLPADKPRYLMGVG 84 46 55%
479 ALA-26-LPL ALALRDEVLDLEAAGIKIIQIDEPALREGLPL 125 44 35%
480 GIG-26-AGL GIGIALGAAIMSYMGDAIRFSSAGQAAPYAGL 88 25 28%
481 ELL-29-NLL ELLRDIDKETVDFVPNYDGTEREPVVLPARFPNLL 69 44 64%
482 LLL-24-ALT LLLAILTLALAALSLLLAAADLSALLAALT 112 4 4%
483 LLE-29-LAL LLELVGLNPAHLGRYPHEFSGGQRQRISIARALAL 102 27 26%
484 TLL-29-DAL TLLLTHNLDTLGQMSCNPAIGGIGKGHLVKEIDAL 77 40 52%
485 IGG-28-LSG IGGGLPVGAFGGRREIMDAIAPLGPVYQAGTLSG 70 40 57%
486 TGL-24-GLG TGLSVVDTGTTFTLFGQIVILLLIQIGGLG 74 34 46%
487 LTG-29-IDL LTGLPNRRALLERLTEALDLARRRGHPLALLLIDL 62 36 58%
488 GSG-29-ELA GSGKTAAFGLPLLQKLDPELKEVQALVLAPTRELA 74 51 69%
489 LLA-25-LGA LLAGTEEALAETLAVAGRAGKAYRAAGALGA 149 17 11%
490 IVD-29-GKL IVDHYTYVFMGDGCLMEGISHEACSLAGTLGLGKL 55 43 78%
491 DLA-24-VID DLAAMRDAMKDLGGDPEKINPLIPVDLVID 62 47 76%
492 LLL-26-LLL LLLLLLLLLLLLLLLLLLLAFALALLLGLLLL 220 2 1%
493 LAK-27-ALN LAKLAGGVAVIKVGAATETELKEKKLRIEDALN 65 36 55%
494 GAG-24-GAG GAGGAGGAGGAGGAGGAGGAGGAGGAGGAG 253 154 61%
495 GFL-25-RLL GFLHDAAEFDAEFFGISPREALAMDPQQRLL 62 46 74%
496 LGV-25-GLG LGVVRVDDERSFVVADIPGLIEGAAEGAGLG 86 45 52%
497 GSG-28-SGG GSGGGGSGGGGSGGGGGGGNGSGGGGGGGNGSGG 96 70 73%
498 ALS-26-SAL ALSGGQQQRVALARALALAPDVLLLDEPTSAL 91 31 34%
499 VLG-28-LTG VLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKLTG 75 26 35%
500 LGL-28-GLL LGLSGGVDSSVVAALLHRAIGDQLTCVFVDAGLL 134 38 28%
501 AAL-24-LAA AALAAAAAAAAALAAAALAAAAAAAAALAA 252 4 2%
502 VIG-29-LSG VIGGGLPVGAFGGPEVIMLVGLPHGPVYQAGTLSG 71 26 37%
503 ALE-26-FLG ALEKLQLNDASLQFEPETSQALGFGFRCGFLG 60 41 68%
504 ALG-28-LGL ALGAFLAGVLLAESEYRHELEGAILPFKGLLLGL 125 22 18%
505 AAL-28-LIA AALGDVGLLLLLLAAILGAAAERLALEALLGLIA 118 1 1%
506 LEA-26-AIV LEAYGAAYTLQELLTVKSDDVVGRVKTYEAIV 64 37 58%
507 LLP-28-GLD LLPRWRGAAPIQRAIEAGDAETGVTIMQMDEGLD 68 36 53%
508 VEL-29-DIL VELGHTYVDNAAMQLLRAPSQFDVDVLANEFGDIL 57 21 37%
509 GVL-24-LLR GVLIDDLVTKGTNEPYRMLTSRAEYRLLLR 75 27 36%
510 LGT-25-GIG LGTKYSEAMGATFLDENGRAQPLIMGCYGIG 62 43 69%
511 LLD-29-LLV LLDEPLGALDALTRLELQDLIDKLVARHGFTVLLV 78 28 36%
512 LSG-24-IGV LSGKPLQEISTLVLRRLSERLGGDLPIIGV 66 25 38%
513 ALG-24-AGL ALGADLLRPAIEALSGIAELLVSAHPNAGL 134 27 20%
514 LEA-26-VLG LEARALMMSTNNILSPANGEPIIVPSQDVVLG 72 34 47%
515 GSG-29-GGG GSGGGSGSGGGGGSGGGSGGGGGSGGGGGSGSGGG 110 43 39%
516 AIA-26-AGL AIAAGNGAVLKPSEEDPLSALLLAELAIEAGL 113 33 29%
517 GGS-29-LGA GGSSDAATVLVALNRLWQLGLSKDELADLGLALGA 73 37 51%
518 AKL-26-ALN AKLAGGVAVIKVGAATETELKEKKLRIEDALN 57 41 72%
519 LDI-27-GGG LDITASSEGRETMLDVVERTAEQVFIPLTVGGG 58 50 86%
520 LLA-26-LAA LLALNAAIEAARAGELGRGFAVVADEVRALAA 217 30 14%
521 LAA-24-EVL LAAILTNLEPGDVLFIDEIHRLSPVVEEVL 92 33 36%
522 LVG-25-IGA LVGAGAAEGAIDAANILKPALARGELQCIGA 75 35 47%
523 TGL-24-LSA TGLSGSGKSSLAFDTIYAEGQRRYVESLSA 72 63 88%
524 LGG-26-GFL LGGDGTILPAARTAAAIGKPILGMNLGFVGFL 66 30 45%
525 LAA-25-LLP LAAGNCVVLKPAEQTPLSILVLLELIGDLLP 111 28 25%
526 VIV-27-AGI VIVDELADLMMVASKEVEDAIIRLAQMARAAGI 63 27 43%
527 LEA-28-IGS LEAMLAVADKEASLIITGTGDVIEPEDDLIAIGS 58 49 84%
528 AAL-29-LLA AALALAALAAALAAGAAGLAAALAASLAALAALLA 208 6 3%
529 GLG-27-LEL GLGNTRFKSSVNRAPRQATLGEPGEKRDLLLEL 71 38 54%
530 EAL-26-GFL EALEKLQLNDAALQFEPETSQALGFGFRCGFL 58 34 59%
531 LFG-25-GIA LFGTVWGIMNSFIGIAAVKQTNLAVVAPGIA 69 45 65%
532 ALL-26-LDG ALLGGSGIGKSTLLRMLAGFERPTRGRILLDG 86 30 35%
533 IGL-27-LIG IGLSGLIGPSLDEMLNVALEMERQGFLIPLLIG 80 20 25%
534 ITL-29-GGG ITLPLLKPAIAFVLILRTIFAFNNFDLIYLLTGGG 58 26 45%
535 RLL-26-ELL RLLLAKLFLKPSNLLVLDEPTNDLDVETLELL 88 26 30%
536 LID-27-VSG LIDGGNTDYLDTIRRNEALAEKGINFIGAGVSG 56 22 39%
537 DVI-24-ILD DVITGLIKANIPTRIAFAVSSKIDSRTILD 54 49 91%
539 ILL-27-VIA ILLTSMDRDGTKFGYDIELTRAISFAVSIPVIA 74 36 49%
540 LGT-28-DAI LGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAI 54 45 83%
541 GGI-27-LGI GGIKDMGGLPDALFVIDADHEHIAIKEANKLGI 66 50 76%
542 VDL-24-LVI VDLAAMRDAMKDLGGDPEKINPLIPVDLVI 58 43 74%
543 GLG-28-IAA GLGGGHDEREQTLNQLLVEMDGFEGNEGIIVIAA 91 45 49%
544 GSL-28-GID GSLSGGNRQKVEIGLKLGTLPALLATSEPELGID 59 34 58%
545 DAL-24-LLL DALRLPPWDALVANLSGGERRRVALCRLLL 97 31 32%
546 VIA-27-LLR VIADHIRTVTFAIGDGALPGNEGRGYVLRRLLR 67 22 33%
547 LIV-29-ALE LIVEDEPDARELLTDLLSREGYTVEEAADGLEALE 65 28 43%
548 IDL-29-GAI IDLFELNEAFAAVVLAVAKDLGIDLEKVNVNGGAI 56 43 77%
549 AAL-26-LTG AALAMYHAAKPELKKLVGGLLLSAALTSFLTG 107 31 29%
550 LGT-29-AIV LGTFAVLAAFGFSINTLTMFAMVLAIGLLVDDAIV 58 43 74%
551 AIG-29-GIV AIGAGLPVQEPTGSMVVDIGGGTTEVAVISLGGIV 71 34 48%
552 NAL-28-GLG NALIPVITVLGLQFASLLGGAVIIEAVFSWPGLG 72 39 54%
553 DLL-24-GAG DLLGRDPVLPDFHLLVACLTGKTVLVTGAG 70 29 41%
554 LVV-27-GKL LVVPVIRDVDKKGIAEISKELADLSKKARDGKL 60 33 55%
555 VLT-24-GSL VLTGGVDANALHRPKRFFGAARNVEEGGSL 65 35 54%
556 LVA-27-AAL LVAAGAALLAALLLAAARLAVVAALLAAALAAL 148 1 1%
557 GSL-27-LGI GSLSLGARREAEIAFLAGKLRALIITSSLELGI 66 19 29%
558 GGS-29-LLD GGSIRIHRGEMQQKVFEILGITEEEQREKFGFLLD 63 34 54%
559 LGG-28-LGI LGGIKDMGGLPDALFVIDADHEHIAIKEANKLGI 81 48 59%
560 EIL-29-IAS EILLTSMDRDGTKNGYDLELTRAVSDAVSIPVIAS 58 44 76%
561 LLD-27-ALA LLDLVGLADKADAYPAQLSGGQQQRVAIARALA 117 43 37%
562 GSG-26-ILA GSGKTVVAALAMYAAATAGYQAALMVPTEILA 61 42 69%
563 GAG-24-ILA GAGSGKTRVLTHRIAYLIDEKGVNPSNILA 76 50 66%
564 AGL-25-LGT AGLHFTEELLYPIKAKGVDIGFLTLHVGLGT 73 27 37%
565 VVL-27-LLV VVLLGTFAVLAAFGFSINTLTMFAMVLAIGLLV 93 32 34%
566 IVG-24-AIL IVGEEHYEVAREVQSTLQRYKELQDIIAIL 68 39 57%
567 VDL-28-LGY VDLTVELEKAATYEEICAAVKAASEGELKGILGY 52 33 63%
568 DLL-29-IGS DLLGRDPVTLDGELIGRYITGKTVLVTGAGGSIGS 60 41 68%
569 GID-25-IAG GIDLDIEDGEFVVLVGPSGCGKSTLLRMIAG 56 39 70%
570 VLL-25-GLL VLLGTFAVLAAFGFSINTLTMFAMVLAIGLL 113 26 23%
571 LLV-26-LLR LLVEMDGFGANEGIILIAATNRPDVLDPALLR 84 55 65%
572 LSG-26-GLA LSGGEQQMLAIARALMARPKLLLLDEPSLGLA 87 61 70%
574 GLV-26-VVL GLVHLSDISWNVAGEEAVREYKKGDEILAVVL 77 22 29%
575 IGG-25-LGG IGGGPGGIAAANRAAQLGAKVALIEAGALGG 78 34 44%
576 AGI-26-DLV AGINAALKVQGKPELILKRSDAYIGVLIDDLV 62 34 55%
577 SGG-29-GAI SGGNQQKAIIAREIDRDPDLLIVSQPTRGLDVGAI 62 32 52%
578 IAD-24-LLA IADGGIKYSGDIAKALAAGASAVMLGSLLA 72 34 47%
579 VLA-27-LAA VLARAPARAAIIDADAAAVGAFLTAALAAALAA 165 16 10%
580 AIT-26-GIT AITTVLAKKGGAAARAYDQIDNAPEEKARGIT 54 43 80%
581 VDL-25-VID VDLAAMRDAMKDLGGDPEKINPLIPVDLVID 56 47 84%
582 LLA-25-NLA LLALNAAIEAARAGEAGRGFAVVADEVRNLA 77 51 66%
583 GVS-26-AGL GVSLEIKPGEFVGLVGPSGSGKSTLLRLIAGL 74 42 57%
584 VIV-29-LLI VIVEPVAGSAGVIPPPKGFLQGLRELCDKHGALLI 67 42 63%
585 LLL-29-VLL LLLDEPLSALDALTRLELQLLLLRLLLLGGLSVLL 152 23 15%
586 GEL-28-GGG GELVSCFLLRVEDDMNSIGRSINSALQLSKIGGG 71 25 35%
587 LLL-25-LGL LLLAGALLLLAAVLLVLLLGLLLLLAALLGL 169 8 5%
588 GIV-26-AGI GIVGIVGNTNANQILYDGLEKLEYRGYDSAGI 67 53 79%
589 AEI-29-LLD AEIRGHRRTYIGSMPGKLIQKMKKVGVKNPLFLLD 64 45 70%
590 EIL-28-VIA EILLTSMDRDGTKEGYDLELTRAVSDAVSIPVIA 60 37 62%
591 GSG-25-EIL GSGKTVVAALAMYAAATAGYQSALMVPTEIL 59 41 69%
592 GIV-29-LLR GIVYIGAEVQGGDILVGKVTPKGETQLTPEEKLLR 65 41 63%
593 TIA-27-TLG TIAMGSTDGLKRGLEVKDTGRPISVPVGKETLG 56 43 77%
594 LVV-28-LSA LVVVTGLSGSGKSSLAFDTIYAEGQRRYVESLSA 75 24 32%
595 LVI-24-GIL LVIACPCALGLATPTAIMVGTGRAAENGIL 64 37 58%
596 LAL-27-GLG LALPLIMAGIRLALALAIGAATLASLVGAGGLG 112 26 23%
597 ALA-27-AAL ALAALAAAAAAALAVALVAAGSAAAAALALAAL 268 2 1%
598 ELL-27-ALK ELLELVEMEVRDLLSEYDFPGDDTPVIRGSALK 75 44 59%
599 GFL-27-LLE GFLHDAAEFDAEFFGISPREALAMDPQQRLLLE 61 44 72%
600 LLA-25-ELA LLALNAGVEAARAGEAGKGFAVVAQEVRELA 113 35 31%
601 VIA-24-GSI VIALSQLSRGVEQRQDKRPVLSDIRESGSI 57 34 60%
602 DLA-25-ELG DLARYRPDGVLEYLGRIDHQVKIRGFRIELG 63 37 59%
603 GVG-28-LGL GVGIPAEELTRLFERFFQADSSRQRRFGGTGLGL 79 34 43%
604 LAA-24-ALE LAALVAAILYVKGIPSRAGLTLAASARALE 112 16 14%
605 VLL-29-VIV VLLLDEPCSALDPISTLAIEELIEELKEDYTIVIV 70 32 46%
606 GLI-29-VLL GLIVAPPKAGKTMLLQNIAQSIAYNHPECVLIVLL 81 37 46%
607 LLP-24-ATL LLPVLEAVAKAGKPLLIIAEDVEGEALATL 72 33 46%
608 GLS-28-GGI GLSGAPLLAKSTEVIRRLAGELGGKIPIIGVGGI 66 35 53%
609 VEL-27-IGA VELPLALPTIMAGIRQAMVLIIGMATLAALIGA 58 36 62%
610 GAG-27-VIL GAGPIVIGQACEFDYSGAQACKALREEGYRVIL 62 22 35%
611 LLD-28-VLV LLDPPIEVRPPELQVDDLLSEIRLAAAGNERVLV 78 23 29%
612 GLA-25-IAG GLAQRIVNGDVPESLKDKRLLSLDMGALIAG 86 47 55%
613 LDI-27-RLL LDIDALKVVSKGVNAMRGEEFGALVITHYQRLL 61 40 66%
614 VAI-28-LDV VAIARALAMDPKVMLFDEPTSALDPEMVNEVLDV 57 50 88%
615 LLD-24-VLA LLDEGRAGDNVGALLRGTKREEIERGQVLA 92 49 53%
616 ILL-29-GAS ILLQGLEGGRLLDFSGDPKVARNVILIMTTYPGAS 63 25 40%
617 VAI-25-GGG VAIVGGSKVSTKITVLENLLKKADKLIIGGG 60 47 78%
618 RLL-28-EAL RLLTDEHGFSWDEAWGVTLQTVSYTNHTLLAEAL 92 28 30%
619 LLD-28-VIA LLDEATSALDAESEGLVQQALERLMQGRTTIVIA 67 36 54%
620 VLE-26-EIV VLEGLEAVRKRPGMYIGSTSKRGLHHLVWEIV 58 50 86%
621 VLD-26-TLL VLDEADRMLDMGFIDDIEAILRALPEERQTLL 64 33 52%
622 LLA-29-LGY LLAEIQADRLLNAYDTIIIDEAHERSLNIDFLLGY 75 28 37%
623 GAL-28-AIL GALLATDLRGLSNDVYFQVGLLTTIGLSAKNAIL 78 35 45%
624 ALA-25-RLI ALAEFLFDDEDAMVRIDMSEYMEKHSVSRLI 78 40 51%
625 GSI-24-LDA GSITSVQAVYVPADDLTDPAPATTFAHLDA 60 47 78%
626 LGG-24-LDG LGGIALGVSTLGGGLASIDSLLEEAAALDG 62 9 15%
627 ELI-29-ALG ELILHALDAGARHIIIGIGGSATNDGGAGMAQALG 61 38 62%
628 LDG-28-LPL LDGTENKSNLGANAILGVSLAVAKAAAEALGLPL 59 32 54%
629 GDL-29-LDI GDLEQRKRDRVLRDFKNGSADVLVATDVAARGLDI 53 31 58%
630 LGA-28-SLG LGAGRWRVFATVTLPLLLPGLLAGTALAFARSLG 76 30 39%
631 SGG-24-VGI SGGMKRRLNIARALAHEPKLIILDEPTVGI 57 46 81%
632 LIV-28-EAL LIVDDEKEIREILKDLLKQEGYEVFEATDGKEAL 78 25 32%
633 ISA-27-IEA ISASHNPYYDNGIKFFGSDGFKLPDAVELEIEA 57 44 77%
634 ALA-25-LLS ALAAALEIQIEEARALALSRLAVLLPLELLS 119 23 19%
635 TLL-25-IAT TLLNGNKEISDFTKNAIKELQEQGVLVVIAT 63 12 19%
636 ALA-26-LIG ALAEFLFGSEEAMIRIDMSEYMEKHSVSRLIG 111 50 45%
637 EAL-24-SVL EALASAMQMAKISAVGASLQENAEPLPSVL 66 22 33%
638 LIG-24-LGA LIGVAAAGQAFGDLAMIALDGTGNKALLGA 86 15 17%
639 LVS-25-LIE LVSVTERTREIGIRKALGARRSDILQQFLIE 58 39 67%
640 GLD-24-IGS GLDYLTLSRAAGTLSGGEAQRIRLATQIGS 58 35 60%
641 GID-26-LGL GIDALKLERLFSRFPRIDLSRSREEGGTGLGL 63 19 30%
642 GIV-28-VVL GIVTYLNPFIGHHNGDYVGKICAETGKSIREVVL 64 13 20%
643 LLL-28-DAL LLLTHNLDTLGQMSCNPAIGGIGKGHLVKEIDAL 98 30 31%
644 ILL-24-LLI ILLVDKKISNLRELLPVLEAVAKAGKPLLI 95 36 38%
645 ILD-27-LVI ILDEATSALDTESERAIQAALDELMKGRTTLVI 53 39 74%
646 LLG-29-DAI LLGTFAVLAAFGFSINTLTMFAMVLAIGLLVDDAI 63 48 76%
647 ALA-27-ALG ALALLAAAIGILLTLGALGLLPKALREAALALG 169 13 8%
648 GVV-28-IAG GVVPVPDPRLDALAEIVKPQRILPTTMEFVDIAG 63 29 46%
649 LLD-26-GVL LLDEPFAGVDPISVIDIQRIIEHLKDRGIGVL 76 36 47%
650 FLG-28-ALG FLGAGARIALAGPALLLVYLICGLFAFFIMRALG 67 32 48%
651 LDL-24-ALI LDLIMGCERRVVYDFVNVIQGEATLNQALI 68 28 41%
652 IVA-25-LIV IVAPPKAGKTVLLQNIAHSITTNHPECELIV 59 32 54%
653 LLK-27-ALE LLKPLLARGELRSIGATTLDEYRKYIEKDAALE 71 21 30%
654 LVV-29-ALE LVVDDEKSIRDLIKLNLEKEGYEVVLAEDGEEALE 67 31 46%
655 ALL-25-LGI ALLAGAALLVAIYLLGGFLAAGLAGLLALGI 103 13 13%
656 IDL-24-IAG IDLDIEDGEFVVFVGPSGCGKSTLLRLIAG 57 40 70%
657 VIA-27-LAE VIAAKAVAFGEALEEEFKSYARAVVVNAKTLAE 76 23 30%
658 IGA-25-SLG IGAGLPAFEPLGSMVVDIGGGTTELAVISLG 64 28 44%
659 TLL-27-LVG TLLHDDVVDESDLRRGKATANALWGNAASVLVG 83 32 39%
660 GLL-26-AIA GLLAALAGALGAARLSSEQPTLGLGLALDAIA 94 15 16%
661 ALK-28-IAG ALKGISLYIPKGEFVGLLGPSGCGKSTLLGTIAG 61 28 46%
662 VIA-24-LPL VIAALVQFLEMVLDKTSPALYRALGIFLPL 70 36 51%
663 VLT-24-LIG VLTDPTTGGVSASFAMLGDINIAEPKALIG 60 33 55%
664 LLP-27-GLG LLPNTLPPIIVALTLSVPLAILAEASLSFLGLG 75 27 36%
665 LLT-26-LTL LLTAAAFGTMKNSENELAEQLITQTGDNTLTL 79 18 23%
666 IDL-27-IGG IDLVVVNLYPFEETIAKPDVTLEDAIENIDIGG 55 31 56%
667 GLV-28-GLI GLVAAGVHPSPVPYAHVVTTTTHKTLRGPRGGLI 72 34 47%
668 GVG-26-GIT GVGYRAQLKGKNLNLSLGFSHPVEVEAPEGIT 53 35 66%
669 SVL-24-ALI SVLTDPTMGGVSASFAMLGDINIAEPKALI 70 27 39%
670 DLV-26-IGG DLVVVNLYPFKETIAKPDVTLAEAIENIDIGG 55 27 49%
671 GSG-24-LID GSGKSVCINSIILSLLYKAHPHEVKLLLID 58 38 66%
672 LGL-29-LGL LGLGLLLAGALGLLLVALGSALAVLLRGALAALGL 144 8 6%
673 VLL-28-LSA VLLIPAHSTVLPNLVDLSTLLTKDIRLNIPLLSA 92 26 28%
674 GAI-27-IVV GAILVVSAADGPMPQTREHILLARQVGVPYIVV 55 44 80%
675 ALG-26-TLL ALGGGVIGDLAGFAAAAYQRGVRFIQVPTTLL 97 37 38%
676 LLV-25-LGA LLVGGIGVSNAGLISVYERTREIGLNKALGA 94 31 33%
677 LGI-29-IGG LGIDYVIPDYSYLVENLDKIKGLFITHGHEDHIGG 71 27 38%
678 ILL-25-DLV ILLRPVDDLELTVRSANCLKAEAIHYIGDLV 59 16 27%
679 GAG-25-LAI GAGSGKTRVLTHRIAYLIAEKGVNPWNILAI 68 36 53%
680 GAS-27-GVL GASLATLGDDVGAALVDVAVSKLLAALILDGVL 65 11 17%
681 IGA-27-LLA IGAGGLGALILLGIALNDGSLALLGAIPAALLA 107 25 23%
682 IVA-27-VLL IVAPPKAGKTMLLQNIAQSITYNHPECVLIVLL 75 46 61%
683 VVI-29-GSG VVITVYADRSFTFITKTPPAAVLLKKAAGVESGSG 53 28 53%
684 ALA-29-AVL ALAAAAAVLLALAGGREAASAGGTLGDAAGVAAVL 168 8 5%
685 IVG-25-IGG IVGASGAGKSTLIKLLDRLLDPTSGAIAIGG 60 20 33%
686 GVV-24-GLG GVVRVDAEKSFVVADIPGLIEGAAEGAGLG 74 42 57%
687 VSV-24-LIE VSVTERTREIGIRKALGARRSDILQQFLIE 52 41 79%
688 VLS-27-ALA VLSGNRNFEGRIHPLVKANYLASPPLVVAYALA 103 44 43%
689 ADL-26-VLA ADLMMTAPKLVELLIARLAQKARAAGIHLVLA 78 19 24%
691 AGL-26-LAE AGLKDPKRPIGSFLFLGPTGVGKTELAKALAE 97 36 37%
692 IGL-25-AIT IGLMKAVDKFEYRRGYKFSTYATWWIRQAIT 58 46 79%
693 GAG-28-GLD GAGGAAHLPGMVAAKTTLPVIGVPVKSKALNGLD 66 29 44%
694 VGI-29-LLR VGIKDTQKTTCTGVEMFRKLLDEGRAGENVGVLLR 58 45 78%
695 LLL-29-LVA LLLGIATWLAGLALQLLALLLIAALALAAGGLLVA 129 7 5%
696 VIL-28-NAL VILLDSITRLARAYNTVVPSSGKHLVGGVDANAL 60 27 45%
697 LAT-26-RLI LATQIGSNLTGVLYILDEPSIGLHQRDNDRLI 56 42 75%
698 TIA-27-ITA TIAGSDSGGGAGIQADLKTFSALGVYGMSVITA 50 31 62%
699 AAL-28-YLL AALAGLGIDNALIEVDAPLIPIMDGSAAPFVYLL 69 12 17%
700 LAS-28-AAL LASIITVWFSRAGEFHADAASARLAGLDAMIAAL 119 15 13%
701 EIL-25-GVG EILETGIKVIDLLAPYLKGGKIGLFGGAGVG 55 32 58%
702 LLL-25-IVV LLLVDAVEGPMPQTGFVGGKALSLGLGPIVV 79 15 19%
703 ALE-27-LGL ALEKLQLNDASLQFEPETSQALGFGFRCGFLGL 87 33 38%
704 LPL-25-LLV LPLIPVNGMAGHLFRAFAVLILAAPLLSLLV 90 17 19%
705 SAL-29-SAL SALGLSGGQQQRLCIARALAVEPEVLLLDEPTSAL 78 27 35%
706 ILL-27-NAL ILLDSITRLARAYNTVVPASGKVLTGGVDANAL 68 37 54%
707 PLL-24-GEI PLLEVRGLTKSFGGIKALDGVDLTLYKGEI 53 24 45%
708 AVL-27-LAT AVLLPLAALAGGALVLAALAALLDAAGAVALAT 86 4 5%
709 VVL-25-IGL VVLLGTFAVLAAFGYSINTLTMFGMVLAIGL 72 32 44%
710 DAL-26-ALE DALEPHADAQTMEIHHTKHHQTYVNNANAALE 83 28 34%
711 IEA-26-KLA IEAKEGVIIQQESKTLADITFQNYFRMYAKLA 60 29 48%
712 IAL-29-VGK IALRNRWRRMQLEEELRHEVTPKNILMIGPTGVGK 51 42 82%
713 GVS-28-SGG GVSRKEARKRAEEYLEKVGLAEKADRRPGQLSGG 59 32 54%
714 VVI-29-VAL VVIRYEGPKGGPGMPEMLAPTSAIVGMGLGADVAL 64 23 36%
715 KLA-25-ALN KLAGGVAVIKVGAATETELKERKLRIEDALN 55 30 55%
716 VLV-25-AGL VLVHGDTTTTFAASLAAFYQQIPVGHVEAGL 100 40 40%
717 ILL-28-IAS ILLTSMDRDGTKNGFDLELTRAISDAVSIPVIAS 65 43 66%
718 LSG-29-IGA LSGGNQQKVLLGRWLALEPKLLILDEPTRGIDIGA 69 34 49%
719 AGI-27-AGL AGIVYALSRLAVEALAGPLSAQGILALPYHAGL 85 16 19%
720 LPL-25-LVV LPLLEKVGQAGKPLLIIAEDVEGEALATLVV 74 19 26%
721 AIG-26-SLG AIGAGLPVFEPTGSMVVDIGGGTTEIAVISLG 63 39 62%
722 LLA-24-VLV LLAEANAPYDIVLEMDEINRRFAATDGVLV 109 25 23%
723 IGV-24-LLL IGVLIDDLVTKGTNEPYRLLTSRAEYRLLL 76 26 34%
724 LIG-25-LDG LIGPNGSGKSTLFNLLTGLYKPSSGEILLDG 57 30 53%
725 GVG-26-LSL GVGKTAIVEGLAQRIVNGEVPEGLRGKRVLSL 64 22 34%
726 VVI-24-GLG VVIRYEGPKGGPGMQEMLYPTSALKSMGLG 60 40 67%
727 GGS-26-LDL GGSEREDDYDALVARMKELGLDQEDYDWYLDL 58 29 50%
728 VAI-28-LDL VAIARALALEPELIILDEPTSALDVSVQAQILDL 56 37 66%
729 LPL-25-IGA LPLALPVIMAGIRQTMVLALGMVVIAALIGA 66 31 47%
730 GVV-26-IVL GVVGAIIPWNFPLPMAAWKLAPALAAGNTIVL 58 22 38%
731 VLL-25-VLV VLLAEAKVPYDIVLEMDEINDDFADTDTVLV 96 25 26%
732 LGG-26-LGA LGGEWGGAALLATENAPLDKLLHAGMDALLGA 93 21 23%
733 LLR-28-GIA LLRMIAGLEEATLGLNGIDGSDVLAAQPGGRGIA 64 42 66%
734 LLL-29-ALG LLLTHNGDTLGAMSCNPAIGGIGKGHLVKEIDALG 135 29 21%
735 GAG-27-DAL GAGLAAAGMNRVVGDHMGMLATVMNLLAMLDAL 75 14 19%
736 VLD-24-VSL VLDALEQALWARRPSGTVHHSDKGSQYVSL 64 37 58%
737 LIG-24-VVL LIGAPPGYVGYEEGGQLTEAVRRRPYSVVL 75 39 52%
739 GAL-27-LGA GALDLLEVPAALPGEGAPVIVAEGADVATILGA 112 23 21%
740 LSV-28-LLA LSVADAIGILAAADALLNLGSTLGLAGVFAALLA 92 23 25%
741 VGK-26-GVV VGKSTLFNALTKAGIKAANYPFTTIEPNLGVV 51 41 80%
742 LLD-24-VIV LLDEPTNGLDIQSISWLEDFLINFENTVIV 61 34 56%
743 ALV-26-LDG ALVGPSGSGKSTLANLLMRFYDPDSGRILLDG 67 42 63%
744 AVL-26-AIG AVLKILAAAGLLVIALGDSDLLHVGDLVLAIG 79 12 15%
745 LGA-29-ITA LGAGANPEVGRKAAEESEEEITEALQGADMVFITA 62 38 61%
746 GLG-28-GEI GLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI 55 26 47%
747 SLA-24-GSG SLAKHYGFDVEAPFNSLSAKVDKVVLIGSG 63 19 30%
748 GIA-26-LAE GIAESFVKTIKRDYISIMPKPDGLTAAKNLAE 73 24 33%
749 NLL-26-NLA NLLALNAAIEAARAGEQGRGFAVVADEVRNLA 54 51 94%
750 ALA-29-VAI ALALAALSLAAVALVLVADGIALTLREAQSQIVAI 94 16 17%
751 LLV-24-IVV LLVDAAEGPMPQTRFVTKKALELGLKPIVV 69 20 29%
752 LVI-26-VVL LVINGEKTVLHLIPSGGLRANVFGIIGNGVVL 62 12 19%
753 LAE-29-VLA LAEALGAILREVLPLGLIAAGGASAKAAGRATVLA 96 2 2%
754 LVE-29-LTG LVEHKKDVVILLDSITRLARAYNTVVPSSGKVLTG 60 37 62%
755 DLI-24-LVD DLILLPVLLLQANPEVRERWQNRIRYLLVD 53 29 55%
756 GAG-27-GGG GAGGNGGAGGDGGYGGGGGGGGGGGGGGGGGGG 130 49 38%
757 ALN-24-LAA ALNAAIEAARAGESGRGFAVVADEVRALAA 75 26 35%
758 LLE-26-ALK LLELVEMEVRDLLSEYDFPGDDTPVIRGSALK 75 44 59%
759 AGI-25-GLA AGIAVAAALGGMALSMAVKIGEVAAAGHGLA 86 20 23%
760 GLI-24-AIT GLIRAVEKFDYAKGFKFSTYATWWIRQAIT 54 30 56%
761 VLI-26-GIG VLIIDDFLANGLAAGGLILLKAIAAAVLAGIG 58 11 19%
762 DVL-28-LAE DVLIAWENEALLARKELGADKFEIVTPSLSILAE 73 34 47%
763 LAL-29-LGL LALAAALAAALAEIVAAGLLAVAAGQLEAALALGL 150 18 12%
764 LGI-27-FGL LGIDEEEQEEKFGFLLDALKAGTPPHAGLAFGL 63 19 30%
765 LGL-29-LPL LGLAIVRRIVEAHGGEIEVESSPGGGTTFTVTLPL 191 116 61%
766 VAI-24-SLG VAIGAAIQGGVLAGDVKDVLLLDVTPLSLG 56 25 45%
767 LIV-26-LIV LIVAPPKAGKTVLLQNIAHSITTNHPEVELIV 63 33 52%
768 GEI-29-VIA GEILLTSMDRDGTKDGYDLELTRAISDAVSIPVIA 52 39 75%
769 AIG-28-AGL AIGALYKMNASISGAEVGCQGEVGVACSMAAAGL 87 34 39%
770 NAL-27-LAA NALVALGGLLAAQLLGFADGREDRGGRAAALAA 75 12 16%
771 IGA-24-RLL IGAEVKDGDILVGKVTPKGETELTAEERLL 66 32 48%
772 GVI-24-LGV GVISKINPEEDMPYLEDGTPVDIVLNPLGV 62 42 68%
773 LTG-28-IAT LTGGVDANALHRPKRFFGAARNVEEGGSLTIIAT 58 34 59%
774 LVS-25-IGG LVSCLTGNPVRADVAMTGEITLRGQVLPIGG 56 25 45%
775 VLI-26-AIA VLIETLLALGAAVRWASCNIFSTQDHAAAAIA 68 19 28%
776 ALS-28-LDV ALSGGERQRLLLARLLLKPPNLLILDEPTNGLDV 59 33 56%
777 LLP-26-GDL LLPKDPNDDKNIFLEIRAGTGGDEAALFAGDL 53 42 79%
778 SLL-25-ALG SLLVGGIGVMNIMLVSVTERTREIGLRKALG 97 22 23%
779 LTG-25-ITL LTGVLVEDDEDAAVAAQVLHDKGIWTVLITL 57 14 25%
780 LLL-25-LVV LLLDEPVAVLDLASRLPLELALLGFAGALVV 109 13 12%
781 IEL-29-LVA IELGEIEAVLLQLPGVREAVVLVREDEPGDQRLVA 58 28 48%
782 LVG-25-ATL LVGYTNAGKSTLFNRLTEAEVYAADQLFATL 75 36 48%
783 IGG-24-DLA IGGGINGAGIALDAAGRGLSVVLEEADDLA 59 22 37%
784 ALG-29-LDI ALGRLAAEDPSKRVWTDEELGQTIIAGMGELHLDI 58 19 33%
785 IAL-27-ALI IALAGALGLVLILYALAEAAAAGILAAGLVALI 89 9 10%
786 LDL-29-LEV LDLITNRESFDIFVTRSKIISEIRRYLDSLGFLEV 55 28 51%
787 AIV-27-AGI AIVTDIAGTTRDVIEEYVNVRGVPLKLIDTAGI 65 47 72%
788 GGG-26-AEI GGGTPSLLSAEAISRLLTALRARFGLAPDAEI 54 28 52%
789 GAI-25-GAI GAIYAKGCLIFGNNGSILFSNNSADLAGGAI 70 14 20%
790 ALA-27-GIT ALAIYHTAKPENKKLVAGLLISAALTSFLTGIT 76 39 51%
791 GLG-26-LIG GLGAIIAKPGYLLEAGEGAFFLVLGGPGGLIG 76 7 9%
792 LLL-24-AKL LLLRRPPGREAYPGDVFYLHSRLLERAAKL 75 35 47%
793 LLG-25-LLG LLGLLLAGLATLLLSLAALLLLGLAGLALLG 128 6 5%
794 GIA-29-AIV GIAPEHLPRLFERFYRVDKARSRQTGGTGLGLAIV 62 34 55%
795 IAA-25-LGL IAAITSCTLTSNFRVLDAAGLRAKKATGLGL 101 18 18%
796 NVL-28-VIG NVLLAEAKVPYDIVLEMDEINDDFADTDVVLVIG 49 33 67%
797 SLA-29-LSV SLALGGALGTIAVLLRQEILLVIIGGVFVVETLSV 66 32 48%
798 LVL-28-LLF LVLDEADRMLDMGFIDDIRKILALLPAKRQTLLF 76 44 58%
799 LVD-27-LSA LVDAQQARRILDRLVGYNISPVLWKKVKKGLSA 61 36 59%
800 EGL-26-IAG EGLAQRIVNGDVPESLKDKRLLSLDMGALIAG 57 47 82%
801 GLA-29-LLL GLAGLAGALPAALSGGELQRLALARALALEPALLL 119 30 25%
802 LLP-25-FLG LLPNALPPIIVLATLLVPGAILTEASLSFLG 56 26 46%
803 EIL-27-ADL EILKVHTRNKPLAPDVDLDKLARRTPGFTGADL 59 36 61%
804 AKL-24-LSG AKLASAHEFIEKLPEGYDTVVGERGVKLSG 62 31 50%
805 AKL-26-IEA AKLRVDMRTEIKRLHQRLKTTTVYVTHDQIEA 56 36 64%
806 LAT-29-GKL LATLERLLSLLSAFEVVVWMTDGWPLYESRLKGKL 57 37 65%
807 VSG-29-IAA VSGGEEGALKGPSLMPGGQKEAYELVAPILDAIAA 63 31 49%
808 LLT-29-SGG LLTSMDRDGTKAGYDIPLTRAISDAVDIPVIASGG 60 37 62%
809 ALL-26-LLA ALLAGAALGALLALAALVAARALLAVLGLLLA 215 1 0%
810 LLD-29-LVE LLDEPSLGLAPIIVQQIFETIEELREQGMTILLVE 70 40 57%
811 LLG-26-LGA LLGALLAAGLAAGGALAAALAAASAAVLLLGA 112 5 4%
812 VLL-28-LTI VLLCDEATSALDPATTDSILELLKDINRRLGLTI 58 23 40%
813 GEI-26-LVA GEIEAVLAQCPGVREAVVLVREDEPGDQRLVA 56 37 66%
814 LLL-24-VAL LLLAVLVLLALLALLLGAALLTAPLVLVAL 126 7 6%
815 LSG-25-LTI LSGGVDPAALHKPKRFFGAARNIEEGGSLTI 56 37 66%
816 LGV-26-GAI LGVDDGDLVLSQPPTGEQALEAILALARSGAI 65 21 32%
817 LLS-28-ALA LLSASLALVALFVYTLVLLLALTFSGVAIAIALA 133 10 8%
818 TLL-28-LAL TLLLTLATVLLVVLLKLLLAAATVAGLLGDALAL 109 11 10%
819 GLS-29-VLL GLSGGANAYPRELSGGQQQRVAIARALAMDPKVLL 78 28 36%
820 ALE-25-IAL ALEGALKLKEISYIHAEGYAAGELKHGPIAL 69 26 38%
821 LPL-29-LIA LPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIA 68 14 21%
822 VVS-27-AIE VVSMPSTNLFDKQDAAYKESVLPSAVTKRVAIE 53 35 66%
823 IVA-26-IVL IVAPPKAGKTVLLQNIAHSITTNHPECVLIVL 63 31 49%
824 LLL-25-VIV LLLDEPTNGLDIQSISWLEDFLINFENTVIV 75 34 45%
825 ILD-28-VVI ILDEPTTGLHFADIQQLLDVLHRLRDQGNTVVVI 47 28 60%
826 AAL-24-LLP AALAALLLALLALLEALLALGSLALGVLLP 107 3 3%
827 ALL-27-LLG ALLASLLGKTGRIAETGAGLLLVALALALALLG 151 22 15%
828 AVL-25-VAL AVLSLALLALGVSLALVLALALLLRALAVAL 103 2 2%
829 LGV-26-GDL LGVQRFDFGRAVLENRIGQVTGLAWTEVGGDL 57 17 30%
830 LLL-26-LSA LLLFLALALLLGARSKLLLSLAALVAALLLSA 114 13 11%
831 LDL-25-AGL LDLTIAAGEFVALLGPSGCGKTTLLRLIAGL 73 40 55%
832 ALG-26-AIA ALGIGGLPRGRIIEIYGPESSGKTTLLLHAIA 99 25 25%
833 LLP-26-LVV LLPVLEAVAKAGKPLLIIAEDVEGEALATLVV 68 40 59%
834 EGL-25-LLA EGLAQRIVEGDVPEVLADATIYSLDMGSLLA 77 35 45%
835 ITA-26-GGI ITASSEGRVVDKDVVERVAEVIFIPFTVGGGI 54 37 69%
836 GFL-26-IPL GFLLGYTAKLISLGLLLPGLLEALKLILIIPL 52 9 17%
837 VAI-29-DLL VAIARALAAEPEVLLADEPTSALDPSTQAQILDLL 56 42 75%
838 LLA-28-LLP LLALAVPLLALLLVAASLAAALALAGALLAALLP 113 6 5%
839 ALA-25-LLL ALALAPLLLLADEATSALDASTRLQILNLLL 190 46 24%
840 GGG-29-GAG GGGGGGAGAADGGGAGGGAGGGGPEGGLGGAGGAG 122 50 41%
841 GLL-26-LLL GLLAGAAAAGGLAGLLLLLLEKAANLEVLLLL 140 11 8%
842 LLA-28-GLV LLAALLVLLLARALAIVDALLGLIAGAALALGLV 115 9 8%
843 LLV-28-GLA LLVSVRVGAAGGLPGMMDTVLGLGLNDGLAIGLA 95 13 14%
844 DLV-24-AIE DLVEEQIRVAAGEKLSFKQEDIKLRGHAIE 57 41 72%
845 LAL-28-LVA LALAYSPGVAAPCLEIAADPAAAAAYTARGNLVA 120 21 18%
846 ILG-29-GIT ILGDEDHLGDMDFKVAGTREGITALQMDIKIEGIT 57 38 67%
847 LVV-28-AAL LVVEDDASVLLAIAGVLIALGLARTLAGSGLAAL 106 2 2%
848 LLP-27-AGL LLPGGRGATLANFITLAGTALLALSAVKGLAGL 80 8 10%
849 GIG-26-SGL GIGIAPEDLERIFERFVQVDSSRARAYGGSGL 59 37 63%
850 IAD-29-ALG IADEDQIGVGDFGVADGMPFGLGQPDLYGLVKALG 60 22 37%
851 LLA-26-LLG LLAAAMGGVGAIAETGAGQHLVASALAAALLG 158 21 13%
852 VLT-26-LTI VLTGGVDANALHRPKRFFGAARNVEEGGSLTI 51 34 67%
853 ALE-25-GFL ALEKLQLNDASLQFEPETSQALGFGFRCGFL 50 41 82%
854 IAA-24-LLL IAAGSELGLAAVVLDVAQALLAVLGAALLL 100 4 4%
855 ILG-26-LLL ILGLLLLLLGGLVSAIIALLVLVILGLLILLL 92 6 7%
856 GGS-27-LAS GGSNVQFAINPKNGRMVVIEMNPRVSRSSALAS 61 44 72%
857 LLD-29-GSI LLDEGRAGDNVGALLRGTKREEVERGQVLAKPGSI 50 37 74%
858 TGL-24-ASG TGLSAALHLAEAGFDVVVLEAGRVGGGASG 63 23 37%
859 VLV-25-GIL VLVIACPCALGLATPTAIMVGTGRAAENGIL 64 41 64%
860 EVL-29-ALA EVLPEDKAAVVKELQAGGGVVAMVGDGINDAPALA 93 31 33%
861 GIV-26-DLL GIVFIDEIDKICKRGESSGPDVSREGVQRDLL 56 28 50%
862 ALG-24-LTL ALGLVAGALLILPLGAAVALGLALSSLLTL 87 7 8%
864 LGT-26-IGV LGTKYSEAMGATVLDENGRNQPLIMGCYGIGV 52 36 69%
865 EAI-27-LLG EAIVLVFLVMYLFLQNFRATLIPTIAVPVVLLG 62 27 44%
866 GSI-24-GEL GSIGLPVPSTEAKLVDDDGNEVPKGETGEL 51 22 43%
867 AIA-26-VLA AIARALAMDPGVLLFDEPTSALDPELVGEVLA 104 32 31%
868 VGL-27-SGL VGLDYLTLSRAAGTLSGGEAQRIRLASQIGSGL 64 34 53%
869 NLL-26-TLA NLLALNAAIEAARAGEQGRGFAVVADEVRTLA 60 42 70%
870 LLE-29-IDL LLEAGVHFGHQTRRWNPKMKKYIFTERNGIYIIDL 59 45 76%
871 VIE-25-KLA VIEMNPRVSRSSALASKATGFPIAKVAAKLA 54 43 80%
872 LIG-24-LLF LIGITAGEAEDPEKSIPKAIAQVFWRILLF 70 26 37%
873 LGG-26-VIA LGGGHDEREQTLNQLLVEMDGFEGNEGVIVIA 66 24 36%
874 NVL-27-AIA NVLCFPGIFRGALDVGATAINEEMKLAAVEAIA 53 39 74%
875 LIE-24-GGG LIEEPMAAAIGAGLPVSEATGSMVVDIGGG 52 42 81%
877 LLV-24-ISG LLVGPPGTGKTLLARAVAGEAGVPFFSISG 58 42 72%
878 LLT-26-LLR LLTEMDGFEELSGVVVIAATNRPDILDPALLR 70 33 47%
879 RLL-25-LEA RLLKERIIFLTGPVEDHMANLIVAQLLFLEA 84 41 49%
880 SLL-25-LLA SLLSIVQMPGGLPVVTLAIGLAGAVLAGLLA 125 15 12%
881 AIA-27-LDV AIARALAMDPKVMLFDEPTSALDPEMVNEVLDV 64 50 78%
882 IGG-28-GGG IGGSATNDGGAGMAQALGAILLDANGFDIGGGGG 71 18 25%
883 EVL-28-VLV EVLELKAVRKGMASGAVIESRLDKGRGPVATVLV 58 22 38%
884 ALG-26-ALV ALGLSGLGAEVMENFIATDAAINLGNSGGALV 103 15 15%
885 ALS-29-DIV ALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIV 51 27 53%
886 GAL-28-LAL GALALALLLALLVLVLLLLVGGLLVAGLLLALAL 114 5 4%
887 AGL-29-LLI AGLAVAAAGALAVFLAVGSIARGLVLFAVDFSLLI 84 6 7%
888 LLA-25-GLA LLALLAAAALARAGAAGRGFAVAAAVALGLA 139 11 8%
889 AVL-27-AIA AVLIETLLALGAEVRGASCLGFSTQDHAAAAIA 99 16 16%
890 VIA-29-LGL VIAESFERIHRSNLVGMGVLPLQFLQGESALTLGL 82 29 35%
891 EAI-26-ALA EAIARNLREMSDLKVPIICTVIGEGGSGGALA 89 43 48%
892 AGL-28-LSG AGLERAARLKQLAATLAEVALEKPLIRGPEALSG 91 17 19%
893 ALV-24-VLL ALVGGSAGGKLTAGTLGVTAALLDGGAVLL 112 4 4%
894 AIV-24-GGG AIVGGSKVSTKLTVLNSLSKIVDQLIVGGG 57 35 61%
896 GVS-27-ELG GVSVATVSRVLNGKGRVSEATRERVLAAIEELG 52 33 63%
897 DVL-27-ILA DVLIAWENEALLARDELGADKFEIVVPKLSILA 55 29 53%
898 AIV-28-GAL AIVVVENVERVMSEEGLPPKEATRKSMGQIQGAL 69 31 45%
899 LAL-24-EAL LALARHATSKIASLDDLEAIRSLGFRGEAL 111 24 22%
900 GLA-29-LLR GLADRATFVIDPQGLIQAVELLAAGIGRDAADLLR 75 16 21%
901 LDG-24-LLD LDGGRFATSDLNDLYRRVINRNNRLKRLLD 59 32 54%
902 LVF-24-LGT LVFLVMYLFLQNFRATLIPTIAVPVVLLGT 47 36 77%
903 VIG-27-LGG VIGGGPAGLAAAIRAAKLGAKVILIEKNPFLGG 69 37 54%
904 VLL-27-EIA VLLKKAAGIESGSGEPNKTKVATVTRAQVQEIA 64 34 53%
905 LLT-25-DLI LLTKALRPLPDKFHGLQDQEQRYRQRYLDLI 55 36 65%
906 LAE-26-GSG LAEQFGVSRMTVRAALDLLVIEGLLERRIGSG 63 27 43%
907 IVS-25-IGG IVSRSGTLTYEAVKQTTDEGFGQSTCVGIGG 51 32 63%
908 LLR-29-LLN LLRELPFGADGKFRLESLPGRVNGNLANDLGCLLN 58 20 34%
909 VVS-25-VFL VVSAADGPMPQTREHILLARQVGVPAIVVFL 45 32 71%
910 IAG-26-GLV IAGLAKPDSGIIAFERADVAKHEAGHRIVGLV 68 13 19%
911 VLE-28-LVD VLEYFISTHGARKGLADTALKTADSGYLTRRLVD 54 42 78%
912 AAL-27-TLA AALEASVRYLAADLGLGGIRVNAISAGPIRTLA 123 22 18%
913 VLV-24-DLV VLVSGTDGVGTKLKLAIDLDRHDTIGIDLV 60 32 53%
914 ELV-24-LDA ELVKIDPKSIGVGQYQHDVDQSQLARLLDA 70 30 43%
915 TLG-28-LGG TLGQEFSGYAAMLDHGLIHIEDALPHLAELALGG 64 21 33%
916 LSG-29-FLG LSGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLG 56 41 73%
917 NAL-25-LTG NALNAALLEELATALDQLEADSAVRVVVLTG 54 16 30%
918 ELA-28-ALA ELALLLARLALLALAALTALEAAGSRSALAEALA 126 8 6%
919 LGV-29-VGL LGVNVERLRLLVLIAASLLTAVAVAAAGIIGFVGL 82 41 50%
920 ISA-29-LIG ISAGLSQNSYRGLVKITPLATNARNFTQCDSLLIG 57 18 32%
921 LGG-28-LLT LGGKAQFGGQRFGEMEVWALEAYGAAYHLQELLT 71 17 24%
922 EAI-25-VVL EAIILVFLVMYLFLQNFRATLIPTIAVPVVL 55 29 53%
923 GAS-25-IGL GASDMSGWLLMGLPGAVYLSGLSESWIAIGL 56 27 48%
924 KLA-24-SGG KLAQAHEFIMKLPEGYDTLVGERGVKLSGG 53 36 68%
925 GVS-25-IAG GVSLTIADGEFVVLVGPSGCGKSTLLRLIAG 55 26 47%
926 LAL-26-ILL LALSSTALGLQLLAERAGTFSPIGRAAFAILL 97 12 12%
927 GID-26-AGL GIDLDIEDGEFVVLVGPSGCGKSTLLRMIAGL 62 47 76%
928 LGI-26-GLA LGIDNLAFAAILSALDPPSAGGVARGIGLGLA 81 10 12%
929 AIA-26-ALG AIALLIDLAVGGAIANDAGAVEVNAVQVAALG 103 14 14%
930 LEL-26-ALI LELDAISKSLIGGKGLFGGGFAVLLGIAIALI 58 8 14%
931 GIV-25-GIG GIVSRSGTLTYEAVKQTTDLGLGQSTCVGIG 60 33 55%
932 GLL-24-LGG GLLPGYATIGIAAPLLLALLRLLQGLLLGG 92 33 36%
933 AAI-26-LGG AAIQGGVLGGDVKDVLLLDVTPLSLGIETLGG 77 38 49%
934 IDL-26-LAE IDLEMTGLDPERDRIIEIATIVTDAELNILAE 59 19 32%
935 GIS-26-IGG GISFTEFSYQILQGYDFAELNKKHGVALQIGG 53 34 64%
936 LDA-24-ALI LDAIAAVVIGGTSLAGGKGRIVGTLIGALI 62 38 61%
937 TGL-27-GEL TGLVIDPYFSGTKVKWILDHVEGARERAEKGEL 58 45 78%
938 EAL-24-LEA EALTAIDINSARATRGGDIEETALNTNLEA 84 34 40%
939 TGL-29-EAL TGLNTHPRAARLVADELAEITGLPFVTAPNKFEAL 63 19 30%
940 SGI-25-ALA SGIRCGLDVIGSIASGADTVVLKLEEAGALA 75 31 41%
941 DIL-26-LLG DILDVTADTATLGKTQGADQLLGKSTYPALLG 61 27 44%
942 GLS-29-ILL GLSLVADALPIQLSGGQKQRVGIARALAMDPAILL 67 27 40%
943 ILG-25-GLA ILGIEEEEQREKFGFLLDALKFGLPPHAGLA 70 15 21%
944 DAL-26-GFL DALGKLSLNDASLFYEPETSSALGFGFRCGFL 50 37 74%
945 ADL-26-VLE ADLIRGKKASQALDILAKGGKKDAVLVKKVLE 57 14 25%
946 GIS-25-VLN GISALRDESDKDGMRIVIELKRDAVAEVVLN 46 38 83%
947 SGG-25-IVG SGGKGQYGHVWIEFEPNEEGKGFEFENAIVG 55 35 64%
948 LSG-24-SLG LSGGEQQMLAIGRALMARPKLLLLDEPSLG 64 29 45%
949 DLL-26-GGS DLLGRDPVAPDTRLISAYITGKTVLVTGAGGS 53 38 72%
950 LID-26-EAL LIDEHSFDWDDARGEPAQFFVYTNHTLLVEAL 63 24 38%
951 RIL-24-VGK RILEYLAVQSRVNKIKGPILCLVGPPGVGK 43 42 98%
952 ALA-27-IGA ALAAFLFDSEKAMVRIDMSEFMEKHSVSRLIGA 103 39 38%
953 LGV-29-IGL LGVNVERERLLLLLVAVLLVGAAVAVAGGIGFIGL 73 31 42%
954 PLL-28-ALL PLLEDRGLTKGFGGLAALDGVDLTIFAGEIAALL 105 21 20%
955 GAG-28-ITA GAGANPEVGRKAAEESEEEITEALQGADMVFITA 60 40 67%
956 LAA-25-IEA LAAAIILLSGWQLDTPLADPMCGSGTLAIEA 88 28 32%
957 GLL-24-EVI GLLASTGSTGDSYDNAMAESINGLYKAEVI 58 36 62%
958 EVL-26-VGL EVLDMTIEEAREFFDAVPAIARKLQTLMDVGL 57 33 58%
959 VLE-28-LDG VLEFVDELLNEDFVFEDKGVKPIVDAKSAVTLDG 55 17 31%
960 LGT-27-GVG LGTIAKSGTKSFLKSLSGDQKKDSQLIGQFGVG 53 30 57%
961 LDL-29-GIS LDLKLVDKVIGVKKEEAIDPARRLMEEEGILGGIS 50 23 46%
962 LTL-26-GVL LTLSRAAGTLSGGEAQRIRLATQIGSGLTGVL 68 42 62%
963 IGL-27-LLL IGLILPHVARSLVGADHRLLLPLALLAGALLLL 102 26 25%
964 VGK-26-GIV VGKSTLFNALTKAGAEAANYPFCTIDPNVGIV 45 33 73%
965 VLS-28-LDL VLSGGEKVRCMLSKMMLSGANVLLLDEPTNHLDL 61 35 57%
966 VVL-28-IVV VVLPGIDAEEGIIEQDKRIAGGAHEAGRGTAIVV 55 21 38%
967 LLR-24-VID LLRAIFGEKASDVKDSSLRVPNGVSGTVID 50 31 62%
968 GEL-29-NAL GELQAETFNAASANIAILGANVHPGTAKGAMVNAL 51 21 41%
969 LLL-25-LTL LLLGAELAALARALAALLLAVLSALLILLTL 105 8 8%
970 LLD-26-NAL LLDSITRLARAYNTVVPASGKVLTGGVDANAL 56 41 73%
971 AAL-28-VLG AALAAILVALRIGFAPPQAGLGLELLAIAAAVLG 112 18 16%
972 GIG-27-GLD GIGKTLGAIILARVGDVKRFGDKKRFVAYCGLD 56 25 45%
973 SGV-24-ISG SGVIADPFTLLPEETVNDAEALMAGLRISG 48 8 17%
974 ALG-27-LVL ALGSVHGAAFGEPVLGQALRHALPGLTGVPLVL 98 25 26%
975 LVS-28-GAS LVSEVGVGTIAAGVAKAYADLITISGYDGGTGAS 53 35 66%
976 IAT-26-AAL IATGFVVDDAIVVLENIARFLEGGPKPLAAAL 74 15 20%
977 FLG-29-LGL FLGWWSPESAGDYASGTNHVLPTYGYTATGLSLGL 64 14 22%
978 LAK-26-ALA LAKVGLADGEDVYPRLLSGGQQQRVAIARALA 97 29 30%
979 LGG-25-TLL LGGGVIGDLAGFAAASYQRGVRFIQVPTTLL 77 43 56%
980 LAT-29-LGA LATIFVTFPFVARELIPLMQIQGTAEEEAALSLGA 72 21 29%
981 LLL-27-SAL LLLFAGAGGLSAVLLLHLLLPDALEGPTLVSAL 106 14 13%
982 LGL-28-ALG LGLALLGAAAAAELALGGAAAGAAGLAAAARALG 115 7 6%
983 VAL-28-ALG VALHAVAAAQLAGGLAAFLDAEAALDPAYAVALG 106 22 21%
984 AAL-26-GLA AALRALGAAALGRLAIDLLGALAAILGAAGLA 155 15 10%
985 LGA-28-VIL LGAGPIVIGQACEFDYSGAQACGALREEGYRVIL 64 14 22%
986 EVL-26-VVL EVLKEHDATGEAHTVAVTLLGRGEVGVAFVVL 60 9 15%
987 VLG-27-LLA VLGVLALVLIAGLIAALPAKADVLLAVPLLLLA 122 10 8%
988 VAI-27-LDG VAIVGPSGSGKSTLLNLLKRLEHPSSGSVLLDG 48 31 65%
989 LLS-25-LVE LLSRQVGVPYIVVFLNKVDMVDDEELLELVE 65 35 54%
990 AIV-25-GGI AIVGGSKVSTKLTVLESLSKIADQLIVGGGI 54 27 50%
991 LLK-24-LEA LLKERIIFLTGPVEDHMANLIVAQLLFLEA 66 37 56%
992 IAD-27-LGG IADKVYIEPRTLEFVARIIRKERPDALLPTLGG 56 21 38%
993 LIG-27-LNA LIGGMVLHEGKIAEMRTGEGKTLVATLPVYLNA 52 33 63%
994 VAI-29-NLL VAIARALILEPKILLADEPTSALDVSVQAEILNLL 52 27 52%
995 GGG-24-RLL GGGRVGGLIAALLGPLGLGVGFAEAAERLL 63 9 14%
996 GID-25-GLG GIDEADLEKLFEPFYRADSSRSRVTGGTGLG 54 21 39%
997 GKL-29-TLA GKLSGFLKEPRKKKVLVVSADVYRPAAIKQLETLA 53 19 36%
998 IAG-26-ITA IAGSDSGGGAGIQADLKTFSALGVYGMSVITA 57 38 67%
999 GGG-27-GAS GGGFTGLSAALHLAEAGLDVVVLEAGRIGWGAS 64 31 48%
1000 GVS-26-EAL GVSACATCDGFFYRNQDVAVVGGGNTAVEEAL 64 50 78%
1001 VLA-24-GVI VLAVGEEAKEMLGRTPGAIVALRPIKDGVI 68 23 34%
1002 GGS-28-AAL GGSSGGSAAALAAGGVPLALGTDTVGSPRGAAAL 82 19 23%
1003 EVI-25-VSV EVIMTVLHAGGKFDDNSYKVSGGLHGVGVSV 46 37 80%
1004 LVG-24-LID LVGPSGSGKSTLLNLLLRLYDIEEGRILID 55 36 65%
1005 VLF-27-LGG VLFVGTKRQAQEAVAEEAERAGQYYVNHRWLGG 54 35 65%
1006 IAG-29-GIV IAGLPDIGRVPIMIDSSKWLVIELGLICIAGLGIV 62 9 15%
1007 GGG-24-ISA GGGSIEDLWAFNEEIVVRAIAASKIPIISA 54 37 69%
1008 DVL-27-VGK DVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGK 47 28 60%
1009 AIE-27-KLA AIEAKEGVPIQKESQTLASITFQNYFRLYKKLA 54 32 59%
1010 AIA-25-EIL AIARALILEPEFLILDEPTGALDSSTQAEIL 62 29 47%
1011 GVV-24-TGL GVVEFDENGRAISIEEKPLQPKSNYAVTGL 55 35 64%
1012 DLV-26-LPL DLVLGVTQMLVKMGHVGKFGEFKGLGLCSLPL 52 26 50%
1013 ELA-24-LAE ELARQEFPDLDVSLRGAVSIARRLQDPLAE 95 30 32%
1014 GVI-24-SGV GVIIDPFFLTPEHTVAEAEELMGKYRISGV 52 26 50%
1015 EAL-29-VSG EALEPEFKDYAQQVVKNAKALAEVLIKRGYRIVSG 60 39 65%
1016 LIG-26-GSG LIGNGANGAPGTGQAGGAGGWLIGNGGNGGSG 60 28 47%
1017 IGA-27-EVI IGAFYQPLAVVIDTDCLKTLPARELAAGLAEVI 47 23 49%
1018 LGS-27-EAI LGSGPIRIGQGVEFDYATVHSVKAIQKAGYEAI 48 24 50%
1019 AFL-26-AAL AFLDAGLFALLALFALAASNILALLLQAVAAL 86 9 10%
1020 IAD-28-ALA IADIFLQQILLRPAEYDVIATMNLNGDYISDALA 74 29 39%
1021 VLA-26-LGV VLAGLLALFGILLASLLSAAALAAVAAAALGV 94 10 11%
1022 IGA-28-ALA IGALMIWDALKAGVLGPGVELVGGTSGNTGIALA 102 16 16%
1023 GVL-24-GVI GVLEPGQASPTIIEDNCFPGARSEQVEGVI 59 19 32%
1024 LPL-25-LGG LPLSLPGLAAGALLVFILSLGLFVTPALLGG 67 29 43%
1025 VLN-29-LTG VLNTDAEGRLVLADKAPGFGDRRKAMLEDVATLTG 47 40 85%
1026 LLL-29-LLV LLLDEPLLGLAPLIVLYILLVLLALLLLGLLVLLV 133 15 11%
1027 LVL-25-VLL LVLLLIGLLLLLGPLIALLLVALLVLLAVLL 98 1 1%
1028 VGI-26-AIA VGIPDPASRLDQYPHQLSGGMRQRVMIAMAIA 60 30 50%
1029 TIA-29-AIG TIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIG 51 29 57%
1030 TLL-29-LLA TLLTLYNIALAGLEAVVIGASLLVGRPGSIALLLA 118 13 11%
1031 ISA-29-IVG ISAASFQETTRVLTEAAVAGKRDELRGLKENVIVG 50 35 70%
1032 LFG-29-ALI LFGTVWGIMHAFIALGAVKQATLAMVAPGIAEALI 64 23 36%
1033 DAL-28-EAL DALTRLADQEELLALEEAAGFTALFVTHDVLEAL 83 28 34%
1034 LDA-24-GEI LDAILEQDPKARVACETYVKTGLVLVAGEI 53 42 79%
1035 EVI-24-GVS EVIMTVLHAGGKFDDNSYKVSGGLHGVGVS 47 37 79%
1036 VGL-27-GIA VGLFGTVWGIMNSFIGIATFQTTNLAVVAPGIA 65 21 32%
1037 IAV-24-GIV IAVYGLLASRLDGAGHLGLTLAGMGSVGIV 54 19 35%
1038 SLL-27-EAL SLLELDVLGEEAALAMLASGLIELLEEEILEAL 76 10 13%
1039 SGG-28-IGA SGGNQQKVLLARWLATEPKLLILDEPTRGIDIGA 54 36 67%
1040 GIV-25-IGG GIVQGGGFEDLRRQSAVGLESDDFPGYVIGG 54 27 50%
1041 LVD-24-VLA LVDARAGSDVQTLRESEILVLLGILNDVLA 69 21 30%
1042 LGG-27-IAA LGGGHDEREQTLNQLLVEMDGFEGNEGIIVIAA 75 45 60%
1043 LGT-25-AAL LGTDGFGRSDSRENLRHHFEVDAGYVVVAAL 84 23 27%
1044 LLA-26-VIG LLAEAKVPYDIVLEMDEINDDFADTDVVLVIG 83 33 40%
1046 TGL-29-LLF TGLVIDPYFSGTKVKWILDNVEGARERAEKGELLF 55 41 75%
1047 EGL-24-ALV EGLAQRIVNGEVPEGLKDKRVLSLDLGALV 61 29 48%
1048 ALG-27-LIA ALGFGLRALFLGLLLMEIILERLAREFGLALIA 89 15 17%
1049 DVL-24-LDI DVLFIDEIHRLSPVVEEVLYPAMEDYQLDI 53 35 66%
1050 GIV-28-IAG GIVEVPDARLNKLAELVNPKKIVPTTFEFVDIAG 58 33 57%
1051 SLA-28-ALA SLAPTPAVGDSLAAVLEAMGLLAGGAHGTTAALA 119 19 16%
1052 IAL-29-SAL IALLALGGAIEGAGEIALEAGDGVLETLGATASAL 73 7 10%
1053 ALT-27-LTG ALTPLAEGEGEMGEFAFGLLAPLLSQALAKLTG 67 19 28%
1054 ALA-25-LLR ALALDPALLLLDEPTSALDPAVQAEILELLR 112 38 34%
1055 LIA-29-LLL LIADGLGTALDVLIQEQILDLLLELGAAGIAALLL 111 17 15%
1056 GLS-28-LGL GLSILLAPDRLKRLVVEGLILLNVATELSVALGL 89 11 12%
1057 GAL-29-GLL GALLAGAGGLLVGRLGATLVSLILLGLLAFVGGLL 98 13 13%
1058 IGG-26-LNA IGGMVLHQGKIAEMRTGEGKTLVATLPVYLNA 48 35 73%
1059 ILL-29-EAL ILLVDDARANALDLELYLGGLGIQVLVASSGEEAL 71 15 21%
1060 GLI-26-LLL GLIVPHLGLRLVGSAILLLIPGGAIIGALLLL 95 12 13%
1061 LVV-29-IGL LVVPLGVIGALLAATLRGLTNDVYFQVGLLTTIGL 65 35 54%
1062 DLA-28-AIG DLAVLKIDSDKVLPVAEFGDSDKLRVGDPVIAIG 54 35 65%
1063 GAI-29-AFL GAIGTGLFLGNARAIGMAGPKMLLGYAIAGIIAFL 54 18 33%
1064 VFL-24-GAL VFLCLAALYESWSIPFSVMLVVPLGVIGAL 53 35 66%
1065 ALE-28-ALL ALELAALPVTYLGGVIALLLGGLGVRLGLFYALL 96 11 11%
1066 LGA-25-ATL LGAPYWDSYARGAIFGLTRGTNAEHIIRATL 78 33 42%
1067 GVG-28-LLL GVGLDFDIEDINYDKIIIMTDADTDGAHIQVLLL 73 26 36%
1068 LLI-27-LLG LLIGFIFGLVSALAAFLKAFVTGRAGDAGGLLG 93 10 11%
1069 GVG-29-LGA GVGSAAVQLLKALGAEVIASTGRAEKAEYLKSLGA 78 33 42%
1070 EVL-29-TLI EVLYPAMEDFQLDIMIGEGPAARSIKIDLPPFTLI 51 27 53%
1071 GGG-28-ALE GGGTALGLVIEKVAALELEGDEATGANIVLLALE 63 21 33%
1072 ALV-26-LIV ALVDLGGERDAIAGYGGDPAQVEPVVELQLIV 66 12 18%
1073 ELG-26-NAL ELGAENYDTIARFNGKPAAGLGIKLATGANAL 47 32 68%
1074 ILD-26-LTG ILDHVEGAKERAEKGELLFGTIDTWLIWRLTG 49 18 37%
1075 AGL-29-GLI AGLVAAGVYPNPVPYAHVVTTTTHKTLRGPRGGLI 77 41 53%
1076 GAL-29-LLS GALALVLGLGVALWGGQLVLLASGAVALALAALLS 81 8 10%
1077 VLD-27-LDG VLDATTGQNALQQAKAFNEAVGITGIVLTKLDG 51 36 71%
1078 LSL-28-GLS LSLILSAYLLEILRGAAAAVPRGQGEAGRSLGLS 73 14 19%
1079 DAL-24-LLE DALLIDDGQFFARKERSQEEFFHTFNALLE 74 13 18%
1080 LAE-26-LDA LAELVKIDPKSIGVGQYQHDVSQSQLARSLDA 84 30 36%
1081 GLA-25-VAL GLAAAGLHLVVAIYATFLARAFDALAGDVAL 105 13 12%
1082 LAL-25-LAK LALNAAAEAARAIERGRDFAVVADEVRALAK 89 13 15%
1083 AIV-24-GAG AIVTAAGLINALKLVGKKLEDIKIVINGAG 60 29 48%
1084 GLI-28-GLI GLINLLEHENSDVRYSAASALGEIKSEAAIPGLI 67 19 28%
1085 SLA-27-AAL SLAPTPAVGDSVALILEAMGLERVGTHGTTAAL 123 20 16%
1086 RLL-28-ALA RLLALVGLAVLADAALSQLSGGLLQRVAIARALA 122 15 12%
1087 ILD-27-VIV ILDEPTTGLHIADIKRLLKVLNKLVDAGNTVIV 45 26 58%
1088 LAA-29-EAL LAAVLAILAAVALLGAAGEGRILAEIVGALAGEAL 131 8 6%
1089 VIE-24-AKL VIEMNPRVSRSSALASKATGFPIAKVAAKL 47 41 87%
1090 SLA-27-VLS SLALMDAGVPIKAPVAGIAMGLVKEGDRFVVLS 63 27 43%
1091 GLV-29-LFG GLVIDPYFSGTKVKWILDHVEGARERAERGELLFG 61 23 38%
1092 LAE-29-AVL LAEFWMVEPEVAFAGLLDLATLAEAMLKSVFKAVL 87 16 18%
1093 LLS-28-LAL LLSGAAALARALALILLLGRLLLSALALLLALAL 119 15 13%
1095 LVL-26-IAL LVLCDLLTAAEALGPFAVIDVATLTGAAVIAL 83 13 16%
1096 GIA-25-AAL GIALHGGFVPYGATFLMFSEYARPAVRMAAL 98 29 30%
1097 LLP-27-IGA LLPTMGGQTALNCALDLARVGVLEKYGVELIGA 56 24 43%
1098 GGI-25-LNA GGIVLHKGDIAEMRTGEGKTLTATLPVYLNA 45 30 67%
1099 LLG-24-FGL LLGCGVTTGIGAVLNTAKVEPGDSVAVFGL 71 22 31%
1100 VLL-26-IVV VLLLVDAFDGPMPQTRFVTKKAFAAGLKPIVV 69 38 55%
1101 VGL-24-ALV VGLAGELLTRYPHELSGGQRQRIAIARALV 81 18 22%
1102 LIE-27-GAI LIEANEAFAAQALAVGKELGFDTAKVNVNGGAI 48 31 65%
1103 AIG-26-LGG AIGGGSGGIASGNRAAALGALCALIEGKALGG 71 13 18%
1104 IGA-28-GIV IGAGLPVAEPTGSMVVDIGGGTTEVAVISLGGIV 57 27 47%
1105 GLA-24-GLI GLAIAGDLMSAASFLGISALVIASGIDGLI 71 13 18%
1106 LVV-28-DAL LVVDDGPILRRLLADALGALGYSVKLARDGADAL 60 15 25%
1107 LID-28-SGG LIDGGNTDYKDTIRRNEALAEKGINFIGAGVSGG 49 24 49%
1108 ALL-29-LSA ALLDAAASARLAVGEALTNLAAAAIGDIKRIKLSA 116 19 16%
1109 ALV-25-LAI ALVPRASPISNRALDFYNTLFDLNASALLAI 80 25 31%
1110 GGS-27-GGG GGSGTNDGGGGMGGALGGGGGDGGGGGIGGGGG 90 41 46%
1111 GLA-24-LAL GLAGAQLLLIAAAALQAVGAAGAGAAALAL 127 4 3%
1112 LTL-29-LGV LTLQVIAAAQKEGGTCAFIDAEHALDPIYAKKLGV 69 31 45%
1113 IGG-27-EAI IGGGTTEVAVISLNGVVYSESVRIGGDRFDEAI 50 32 64%
1114 DLI-25-LVG DLIYRTIEPKFNAVKDAILSRSDIGQVVLVG 49 24 49%
1115 LSL-27-LLA LSLVLSLLTGAALAAVIRGLALALAVAQLALLA 119 2 2%
1116 AGL-25-EVI AGLLASTGSTGDSYDNAMAESINGLYKAEVI 53 36 68%
1117 ILD-25-GAS ILDSRGNPTVEVEVTLEDGSFGRAAVPSGAS 45 38 84%
1118 ALA-29-LAE ALAAEPAVMLFDEPTSALDPELVGEVLRVMQALAE 141 31 22%
1119 RLI-25-VVL RLIGAPPGYVGYEEGGQLTEAVRRKPYSVVL 49 31 63%
1120 AIG-28-GLA AIGANGLAAALAGINVLRLGSAVGALGGALAGLA 71 10 14%
1121 LLP-26-LLG LLPTLGFLRLLNELLALSRTGLGTLLRVQLLG 84 20 24%
1122 LPL-26-AIG LPLRGKILNVEKAALDKILANDEVGGIAIAIG 56 20 36%
1123 TIA-25-GVG TIAKSGTKSFLESLSGDQKKDSQLIGQFGVG 48 32 67%
1124 LAL-27-IAA LALALAAQALVLVLGKGLLAAGATAAAQGGIAA 106 11 10%
1125 LIG-24-VLL LIGAPPGYVGFDQGGLLTEAVIKHPHAVLL 83 31 37%
1126 IGL-29-ALI IGLRNLDLIMGLERRIVYDFVNVILGGAPLNQALI 69 20 29%
1127 GAG-27-VGL GAGNLIFPPMLGLQAGENVWPAAAGFLITAVGL 71 34 48%
1128 GSL-29-VIA GSLYDASRDTDKIRLAGLGAKVAGSNSKKGDLVIA 60 18 30%
1129 LIG-25-GGS LIGNGANGAPGTGAAGGAGGWLGGNGGNGGS 56 29 52%
1130 AIA-27-LDL AIARALALKPKVIILDEPTSALDVSVQAQILDL 69 37 54%
1131 LGG-26-LSV LGGALGTIAVLLRQEILLVIIGGVFVIETLSV 58 33 57%
1132 TLA-28-SGV TLAAVHTLGIPVDLPTALLLSVVAAVSACGASGV 59 20 34%
1133 AIG-29-ATL AIGIDPAFDDLSQLRYGKICILADADSDGLHIATL 61 16 26%
1134 NLL-29-AGI NLLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGI 51 30 59%
1135 LGL-28-LAL LGLLVLAVALLIGAGLQGAYVLGGLLLLALALAL 136 6 4%
1137 ALA-28-GLI ALALLIAAVLLGAIGGLLTLTLLGRSLGGQIGLI 94 7 7%
1138 IGG-29-AAL IGGVAIPLIAGLLALLVGDVAWHAKRLALLGAAAL 79 26 33%
1139 LSL-26-GVL LSLDGDPGDLLGGTAYRIRLASVIRSGLVGVL 75 19 25%
1140 LTL-24-LTG LTLERAAGTLSGGEAQRIRLATQIGSGLTG 63 22 35%
1141 LSL-28-YLL LSLFILRLLEEEALKELTQEVFAWEGVGIASYLL 60 26 43%
1142 ALG-25-LLA ALGLALARVAGLGGGADDYLLLPLALLELLA 141 17 12%
1143 LTL-25-LGI LTLAPLFSVGGIGLGPISLFIIKLRYTFLGI 68 12 18%
1144 NLL-27-AAL NLLKPALARGELRCIGATTLDEYRKYIEKDAAL 68 28 41%
1145 IVS-25-GKL IVSAWNPGEVDTMALPPCHALFQFYVADGKL 46 31 67%
1146 ALE-28-GLL ALEKLQLNDASLQFEPETSQALGFGFRCGFLGLL 68 33 49%
1147 VAI-27-VLA VAIARALAMLPSLLLFDEPTSALDPETVGEVLA 67 28 42%
1148 TGL-25-LLL TGLANRRLFYLELEKAVAKARRLATDLALLL 74 9 12%
1149 VLA-29-TLG VLADGTVILPLMVRAKRLAGYDLTQLLEGAAGTLG 68 27 40%
1150 VLG-25-GLV VLGTSSSESALPRLLDKMEKAGCKKSVVGLV 76 31 41%
1151 VLA-24-GKL VLAAAHAAANSIAFACAVANAAAGAVAGKL 57 18 32%
1152 LIV-27-IVL LIVAPPKAGKTVLLQNIAHSITTNHPECELIVL 55 34 62%
1153 GAS-28-LGI GASTADLAILLVDARKGVLVQTRRHSFIASLLGI 61 33 54%
1154 GSI-26-IGL GSIGGGLFVASGAYIVQAEPGGLGLYCMLIGL 50 8 16%
1155 GLG-28-AAI GLGETLTSGLVSALGRSGLNRENLEAFIATDAAI 72 14 19%
1156 VAL-28-SLG VALLGADLAFVVILVRLALLRIAGAGGEAAASLG 70 5 7%
1157 VVL-24-ALI VVLVALLAGVAVLLIIIAGVILIAGVGALI 73 6 8%
1158 GVS-24-AIE GVSKSTVSRVLNGPGNVSEETREKVLEAIE 46 26 57%
1159 LLG-29-GVI LLGRVVNTLGAPIDGKGPILAAGASPVEAIAPGVI 67 25 37%
1160 LGI-29-IGL LGIGSPLIYLLLGLLGLKSVGLVVSIAGLIGFIGL 67 9 13%
1161 PLL-28-LLD PLLLGLLLNLTDVQSGVLNIAFLIADLEGLLLLD 66 15 23%
1162 LLE-25-VFL LLERAPRQLSGGQRLRVAQGKVLVKAPDVFL 47 23 49%
1163 LEA-27-AIG LEAMLAVADKEASLIITGTGDVIEPEDGLIAIG 54 46 85%
1164 GGS-26-ALA GGSNVQFAINPKNGRMVVIEMNPRVSRSSALA 79 44 56%
1165 LLG-28-IGS LLGRDPVELDMSLISAEITGKTVLVTGAGGSIGS 62 33 53%
1166 GGG-25-LLS GGGVIGDLAGFAAASYQRGVRFIQIPTTLLS 60 25 42%
1167 VVS-28-IEA VVSMPSTNLFDKQDAAYRESVLPSAVTKRVAIEA 46 29 63%
1168 VSV-26-SVV VSVQAQVLNLLKDLQEELGLTYLFISHDLSVV 47 33 70%
1169 ISA-28-VIV ISAASFQETTRVLTEAAVAGKRDELRGLKENVIV 50 35 70%
1170 LLT-25-ALL LLTEMDGIEANSGVVVIAATNRPDVLDPALL 112 33 29%
1172 VAL-28-GVL VALFRLLEVAGIAPDYVAGHSVGELAAAHLAGVL 83 21 25%
1173 ADL-24-VGL ADLALLLANLSSLRDRPLPEDLVVFGEVGL 57 23 40%
1174 LSA-28-LSV LSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSV 67 30 45%
1175 VGL-27-LLL VGLIVPHLARLLVGADLRLLLPLSALLGAALLL 105 22 21%
1176 VFL-27-LLV VFLPLSDTGGNAGEGFLQFAAAIQIAVLASLLV 63 25 40%
1177 AIV-26-LDG AIVGPSGVGKSTLIALLKRLYECISGAILLDG 49 17 35%
1178 SGG-24-EGL SGGEQQMLAIARALLTDAPLLLLDEPTEGL 49 40 82%
1180 AIV-24-DAI AIVGDDCRVLNEDGLRFELEFVRHKGLDAI 49 20 41%
1182 AAL-25-LDA AALAGTTGDIDRAAEALALGALALLAGALDA 113 2 2%
1183 ALK-29-AGL ALKNINLSIAKGEFVALLGPSGCGKSTLLRAIAGL 72 29 40%
1184 LLF-24-EVI LLFERFLNPERVSMPDIDIDFCQDRREEVI 44 36 82%
1185 DIL-27-LGL DILDVIADTATLGKTQGADQALEKSTYPALLGL 61 27 44%
1186 GAG-26-AIT GAGSGKTRVLTHRIAYLIDEKGVNPWNILAIT 52 43 83%
1187 GAG-29-ALA GAGGAGLATLAALAAAGAGGVVGAARAAERAAALA 123 8 7%
1188 SGG-24-LGL SGGEQQMLAIGRALMSRPKLLLLDEPSLGL 71 52 73%
1189 FLG-28-GEL FLGRGDQYPIALEGALKLKEISYIHAEAYAAGEL 47 42 89%
1190 GVL-28-LIE GVLQGDVKDVLLLDVTPLSLGIETLGGVMTKLIE 56 28 50%
1191 AIG-29-LLD AIGIAGMDRLLGANVIAKSGRAVEAAGDVDVLLLD 58 21 36%
1192 VGL-26-GIG VGLIILDCGVIGIAEADITKLPMGERARDGIG 59 23 39%
1193 AIA-24-EAL AIAAIMELMNKLAKAPEAGEQDRALLQEAL 85 17 20%
1194 LDG-25-LDL LDGGRFATSDLNDLYRRVINRNNRLKRLLDL 53 32 60%
1195 SGL-24-LIG SGLITPSLDEMAHVAKEMERQGFAIPLLIG 60 22 37%
1196 GGS-25-SAL GGSNVQFAINPKNGRMVVIEMNPRVSRSSAL 53 45 85%
1197 LVG-25-ILL LVGAPPGYVGYEEGGYLTEAVRRRPYSVILL 71 23 32%
1198 GLD-27-GLV GLDYYNRTVFEWTTSGLGAQGTVCAGGRYDGLV 52 21 40%
1199 DVL-27-LVD DVLGKYHPHGDSDCYEAMVLMAQPFSYRYVLVD 55 18 33%
1200 GSI-27-GLA GSIIETPITANFREGLNVLQYFISTHGARKGLA 58 31 53%
1201 ILD-26-TLI ILDEPSIGLHQRDNDRLIEALKKMRDLGNTLI 46 19 41%
1202 EIV-27-AGL EIVGYAMGERMTKELTGKALFMALRSQRPPAGL 54 36 67%
1203 ILL-27-LLG ILLLILFCQLLVRLLGAAALGGAPALLVLSLLG 91 9 10%
1204 LTL-28-ALG LTLGQLISGVVAVLTEELLALIPALPREAELALG 87 28 32%
1205 GIG-27-GIG GIGIAKAEAIIIYREFNGGFKSLEDLLNGSGIG 86 27 31%
1206 LTG-29-SLV LTGTSSSVASGRIAYVLGLEGPAVTVDTACSSSLV 54 28 52%
1207 LLK-26-AAL LLKPALARGELHCIGATTLDEYRKYIEKDAAL 79 30 38%
1208 DLV-28-LSA DLVDAQQARRALDRLVGYNISPILWKKVKKGLSA 60 28 47%
1209 VLG-27-LGG VLGAGPAGYSAAFRAADLGLKTVLDERYGTLGG 81 23 28%
1210 GIA-27-ALG GIARILAVAMGGYVDVDNRAAAAAASSQAGALG 79 12 15%
1211 LLL-27-GDL LLLPKDPNDDKNAILEIRAGAGGDEAALFAGDL 71 38 54%
1212 LLV-25-VID LLVAAAVGVESATEERAELLRSAGADAIVID 52 15 29%
1213 ALG-25-GEL ALGRLAQEDPSFRVKTDEESGQTIIAGMGEL 65 24 37%
1214 ALG-29-GLF ALGAFLAGVLLAESEYRHELEGPIEPFKGLLLGLF 62 23 37%
1215 GSL-29-AAL GSLPVGAGVEAAADLLVRLAGAGAHVALALLLAAL 86 8 9%
1216 TGL-28-ELL TGLVIDAYFSGTKVKWILDHVEGARERAERGELL 57 30 53%
1217 LGF-29-GLA LGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLA 63 24 38%
1218 VVL-24-AIG VVLLGTFAVLAAFGYSINTLTMFAMVLAIG 60 31 52%
1219 VSV-25-AGL VSVALGADGATILGAVTPVPKKLSEYAFAGL 58 9 16%
1220 TIA-27-VLA TIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLA 58 30 52%
1221 AIL-26-LLL AILAFLVQVLEGLLRALEALLVLRIGLGLLLL 91 7 8%
1222 VLG-24-LGT VLGAIARAAGFSIFKFIRYIREELLIVLGT 61 25 41%
1223 GKL-25-GGI GKLQVELAQLRYLLPRLVGGGTHLSRQKGGI 49 39 80%
1224 LGV-27-TLA LGVTGSGKTFTIANVIAQLQRPTLVLAPNKTLA 69 43 62%
1225 VLT-24-LAI VLTNKYAEGYPGKRYYGGCEGVDIVETLAI 59 22 37%
1226 TLG-26-GIV TLGRFQLTDIPPAPRGIPQIEVTFDIDKNGIV 49 26 53%
1227 FLA-26-ITL FLAGLQAIPQELYEAAKVDGANKWQQFFRITL 53 25 47%
1228 GLV-27-LLA GLVVAVLALGLLGSLLLRGLLRIALGLAGALLA 107 4 4%
1229 LVG-29-AAL LVGGLSFTASAVNRATQALRAAGSAFKPFVLSAAL 105 18 17%
1230 LLR-25-GID LLRGQNLVGYRNYPDDVVEKFVQKSAENGID 50 35 70%
1231 ELI-26-TGL ELIARLAQKARAAGIHLILATQRPSVDVITGL 46 24 52%
1233 VGI-25-IAL VGIPDAEKRLKSYPHQFSGGMRQRVVIAIAL 55 26 47%
1234 LLA-24-SLG LLAGTLEAPGELLLIDGRLYKLYRGMGSLG 88 20 23%
1235 IAD-29-LAA IADAFLQQILLRPAEYDVVATMNLNGDYISDALAA 72 30 42%
1237 ALV-24-AAL ALVALLAAAITLAAAAAARRGAAIAIGAAL 141 11 8%
1238 GAI-24-GLA GAIGLVDAKVVAVTEAPRLVAILVDAVGLA 66 9 14%
1239 LLL-29-VLE LLLAGILKFAGGLVGLDELAAAIGEERETREGVLE 71 15 21%
1240 ADL-28-GAS ADLNAGLIDEKEAKKRRKEVAQEADFYGSMDGAS 60 42 70%
1241 LDG-24-LLE LDGGRFATSDLNDLYRRVINRNNRLRRLLE 57 21 37%
1242 LVE-29-LSG LVEQGKDVVILLDSITRLARAYNLVIPASGRTLSG 57 28 49%
1243 GID-25-GKL GIDLVAMCVNDLVVQGAEPLFFLDYFATGKL 44 35 80%
1244 LTI-28-ITA LTIAGSDSGGGAGIQADLKTFSALGAYGMSVITA 44 31 70%
1245 RLL-28-AAL RLLAALAALAAAAALLALLAAAADERLRALAAAL 120 1 1%
1246 AGI-24-ITL AGIAMCTALVSALTGNPVRADVAMTGEITL 51 33 65%
1247 GAS-29-AGL GASAYSRVIDFKKFREIADEVGAYLMVDMAHIAGL 75 37 49%
1248 TLA-27-AIG TLADGFEYLLAGLGAGLDVDAFAMRLSFGLAIG 61 10 16%
1249 AIA-24-ELI AIAVEPEVLLLDEPTSALDPIATALAEELI 57 11 19%
1250 GLI-28-AAL GLIGTGPAGLALFLGTIKGLLASVVPALAAAAAL 87 11 13%
1251 LSV-26-LVG LSVAFLQQGGVRAAVSFVSLDIAAGETLALVG 59 16 27%
1252 DLA-27-SVL DLADGHVKALEKLANKAGLHIYNLGTGKGYSVL 51 33 65%
1253 VGL-24-LAT VGLSAKATYYPAQLSGGQKQRVGIARALAT 63 25 40%
1254 YLL-28-LTL YLLQLGDILAVSSLTSGVSVDVGAGGEGITLLTL 53 11 21%
1255 LAL-25-LFG LALSYAAGIGGGRAGVIETTFKEETETDLFG 76 20 26%
1257 TLL-29-TLA TLLGVTGSGKTFTIANVIAQVQRPTLVLAHNKTLA 71 45 63%
1258 LVG-27-LVS LVGAGPGDPGLLTLKGLQALQQADVVLYDRLVS 60 30 50%
1259 LIG-25-IGA LIGAGTGEGAIDAINGLKLQLAALGLQNIGA 61 28 46%
1260 VIG-25-LAT VIGGGNLFRGAGLAAAGMDRVVGDHMGMLAT 61 29 48%
1261 DAL-27-FLG DALGKLSLNDASLFYEPETSSALGFGFRCGFLG 46 37 80%
1262 SLV-25-GLV SLVNKTSGRVVVFGYDLDKDLVAAKRAIGLV 59 20 34%
1263 LLE-28-LLG LLEIRNLSKSFGGQTALDDVSLTIYKGEIFALLG 74 20 27%
1264 AGL-24-GAG AGLHFDEALLAALRAKGVEAAFVTLHVGAG 108 37 34%
1265 LLK-27-SLL LLKHYDEKGLEFYTNLGSRKASQIELNPRISLL 64 9 14%
1266 LVV-26-VAL LVVAAVDGVMAQTREHVLLAPNVGVPQLLVAL 80 18 23%
1267 ALE-26-EAI ALEAYGAAYTLQEILTVKSDDVVGRVKTYEAI 61 39 64%
1268 ELA-28-GDL ELAIRFGRTKRRVDELPAALAKRGYGAEGIHGDL 58 9 16%
1269 VSL-26-GLV VSLIVKFGEILGLLGPNGAGKTTLVYLILGLV 60 22 37%
1270 IVG-25-LDG IVGPSGSGKSTLLKLLPRLYEPSSGQILLDG 47 33 70%
1271 IGG-26-AIA IGGKQALETVQRLLPVLCQAHGLTPEQVVAIA 65 22 34%
1272 AKL-25-SGG AKLAGAHEFIEKLPEGYDTVVGERGVKLSGG 48 34 71%
1273 LLS-28-ALL LLSLLIFALLSAVAPVFFLAARGGIVGAAVAALL 124 6 5%
1274 VGK-24-IGL VGKTTSSAAIATGLALKGKKVVVIDFDIGL 42 31 74%
1275 ALA-26-ASL ALAAVTAALGLVLTAAAVAVSPQALARALASL 130 9 7%
1276 AGL-24-LGG AGLLVAAATGAMVVDILGGTTAVAVISLGG 103 17 17%
1277 AIT-24-LLG AITGSNKRPLKSLADMIKGKQGRFRQNLLG 58 24 41%
1278 VLS-29-LSV VLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSV 58 28 48%
1279 GAG-26-GVI GAGAAAIACERLQTLNGLLVEMIGFCDNKGVI 57 42 74%
1280 VFL-29-GIT VFLVGMEEGVFPHSRSLEDPDELEEERRLAYVGIT 43 33 77%
1281 GLV-27-LEV GLVHISQISHKRVEDPHDVLKVGQEVKVKVLEV 62 44 71%
1282 SLA-26-IGG SLAFILGVVPLALATGAGAMLAFALGTGSIGG 59 16 27%
1283 SLV-29-LVG SLVEDLVGRSIEPLKVALKDAGLSVSDIDDVILVG 59 26 44%
1284 GLG-29-LGI GLGEIGKNTYAVLFQDEIIIGDAGIKFPEDKLLGI 66 21 32%
1285 VLD-24-LGS VLDDGRLTDGQGRTVDFRNTVVIMTSNLGS 46 32 70%
1286 LNA-26-LTG LNALNGNLLLELNAALDETAADSEVRAVVLTG 47 15 32%
1287 LGA-28-VLF LGAFFAGMVLNESELSHRAAIDSLPLRDAFAVLF 54 17 31%
1288 VLV-29-EAL VLVVDDESDLRELLKVVLKELGYEVGTAEDGVEAL 66 30 45%
1289 LVD-29-LVD LVDDVLYTGRTIRAALDALHDLGRPRARFLAVLVD 52 21 40%
1290 LGG-28-LIE LGGTGGGIAANEEELKEITENGLKLSPVTQCLIE 55 25 45%
1291 AGL-29-LLG AGLLAAILALGAGAPTAAVGALLTLATLVLGALLG 116 1 1%
1292 ALI-29-VLA ALITANSTLPGTSIYLKTVDLEDAVKEGAADVVLA 97 21 22%
1293 VFL-29-GGG VFLDITASHEGRKTMIDVVERTAEQVFIPLTVGGG 45 33 73%
1294 GLA-27-ITA GLAKAAIAGFVNGELVDANDLIETDAQLAIITA 56 12 21%
1295 GGG-28-ASG GGGFTGLSAALHLAEAGASVVLLEAARIGWGASG 66 34 52%
1296 LSL-24-IAG LSLSVGDGEILTLLGPSGCGKTTLLRMIAG 67 23 34%
1297 GGG-26-EAI GGGTTEVAVISLNGVVYSSSVRIGGDRFDEAI 51 32 63%
1298 DAL-24-LLD DALKAAARKAAERKTGARGLRAIVEAGLLD 70 13 19%
1299 GVG-26-GLA GVGVRTAARLLAEAAARAFASVALLAADAGLA 71 12 17%
1300 LIG-28-GAI LIGFAGPRVIEQTVREKLPEGFQRSEFLLEKGAI 61 21 34%
1301 IAD-27-GLI IADEPTTALDVTVQAQVLDLLRELVKARGLGLI 50 22 44%
1302 LIG-25-LLG LIGIGGAGKSGLLGALAGIILPGGGGGLLLG 91 7 8%
1303 LTL-27-LAL LTLGQEFSGLVAALEEELLAIILSLPHVAELAL 105 17 16%
1305 GLV-26-VLE GLVHISQISDKRVEKPSDVLKAGQEVKVKVLE 69 43 62%
1306 GIG-28-ASL GIGLGLALLAAELGAPAALAITQAEGLDVVFASL 57 8 14%
1307 GVI-24-EVI GVILPPDGYLPRLREICDKYGILLIFDEVI 44 22 50%
1308 LAL-29-DIL LALMDAGVPIKAPVAGIAMGLVKEGDKFVVLSDIL 57 32 56%
1309 VVL-25-VLI VVLDSAEGPALTGDLATLLRIVDAIGGDVLI 60 8 13%
1310 VAI-26-AVL VAIASLLDMNLAFDGIPLAKGSVSMTMNGAVL 64 13 20%
1311 TLA-27-ILL TLAKSLNVPFAIADATSLTEAGYVGEDVENILL 66 36 55%
1312 LAA-24-LLK LAAFLQFASDLDDATAKQVLHGQKVTELLK 79 12 15%
1313 GLG-27-GSI GLGTMGFGLPAALGVKLALPDETVVCVTGDGSI 53 24 45%
1314 DLI-28-SAI DLIRGKKVAQAIAILKFTPKKAAVLVKKVLESAI 43 31 72%
1315 LTG-27-LVA LTGITDDMVLGAPPAVEVLQAFQDFGADTILVA 72 20 28%
1316 LLL-28-LFG LLLAAISFLLKLTLILLLGQLGIFLALDLILLFG 82 6 7%
1317 ALL-26-LLE ALLRRQAELDGMPAINAKRVYRLMRQNALLLE 100 25 25%
1318 LLV-29-ALE LLVEDEEVNREVARRALEKLGYEVDVAADGKEALE 65 26 40%
1319 LTL-26-ELA LTLGQEPSGWVAMLEHKLAHIEESLPHLLELA 68 21 31%
1320 GSG-24-EIA GSGKTEVYLEAIAEALEAGKQALILVPEIA 48 23 48%
1321 TLL-26-AAL TLLAVLAGLLTPPQGLVALLLAPGAALTAAAL 103 7 7%
1322 VGL-29-LTG VGLDYLTLSRAAGTLSGGEAQRIRLATQIGSGLTG 60 36 60%
1323 LLA-25-TLA LLALNAAIEAARAGEQGRGFAVVADEVRTLA 111 42 38%
1324 IVG-25-ILG IVGEEHYEVAREVQRILQRYKELQDIIAILG 55 42 76%
1325 VAL-27-LDG VALVGPSGAGKSTLANLLTRFYPLDSGEILLDG 59 32 54%
1326 IAV-27-GIL IAVLSGAGGVGLGLATPNLALALAGRGAEVGIL 51 30 59%
1327 VSG-27-LDV VSGGQLQRLMAAMALALQPDLLIADEPTSALDV 45 22 49%
1328 SLL-26-LGA SLLAGGIGVMNIMLVSVGERTREIGLAKALGA 83 19 23%
1329 LSG-27-GGI LSGAPLQLKSTEVIKRLSEELGGRIPIIGVGGI 55 34 62%
1330 DLV-25-ELG DLVRFTGDGELEYLGRKDAQVKIRGFRIELG 52 25 48%
1331 VFL-28-VGI VFLVGMEEGVFPHSRSLEDPDELEEERRLAYVGI 45 33 73%
1332 ALA-24-RLL ALAALPELLIADEPTSALDPTGQAQIIRLL 121 22 18%
1333 ALI-24-NLL ALILEPKLIICDEPVSALDVSIQAQVLNLL 55 31 56%
1334 AAI-28-VLA AAIAGAGPLVGPVLAAQMGLLPGGLWLLAGVVLA 89 20 22%
1335 SGL-28-IAA SGLLAALAGLLLIARLSSANGGAGNGLELDAIAA 63 16 25%
1336 IAV-28-AIG IAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIG 57 36 63%
1337 LAS-26-RLL LASQIGAGLVGVMYVLDEPSIGLHQRDNERLL 72 31 43%
1338 LLD-25-IVV LLDEPTNGLDIQSISWLEDFLINFENTVIVV 50 30 60%
1339 GLA-25-VAI GLAIGGYKPGVAIYSTFLQRGYDQVLADVAI 70 13 19%
1340 LIV-27-VVL LIVALASVCGFGIQVGLLFNGAPAWADVGFVVL 56 13 23%
1341 LVD-28-VLV LVDDVLYTGRTIRAADDLLSEIGRPAAIQLAVLV 53 19 36%
1342 ALS-27-AIG ALSPSKVLGLVVDEAGKALTVLVPAGQLSLAIG 67 16 24%
1343 AIL-25-AIV AILRARGALINTLTMFGMVLAARLAVDDAIV 58 10 17%
1344 ALL-26-IGS ALLAVADKTASLIITGNGDVIQPENDLIAIGS 64 23 36%
1345 ELA-26-GGI ELAFLNRGLRISIEDKREGEEKEETFHYEGGI 55 29 53%
1346 LVE-28-VLT LVEHKKDVVILLDSITRLARAYNTVVPASGKVLT 51 32 63%
1347 LLL-26-VVI LLLDDPTNGLDALTLFVLELALLAFLGPIVVI 66 18 27%
1348 LLE-29-LLL LLESELFGHEKGAFGGALLAAIGRFELANGGTLLL 88 15 17%
1349 LVL-27-ALG LVLADALTYAERFEPELVIDVATLTGAAVIALG 94 46 49%
1350 LLD-25-VFL LLDRKPKQLSGGQRQRVAMGRAIVREPQVFL 47 33 70%
1351 SAI-25-ALS SAILGMHAIKDRPVAVNGQVVILPMMYLALS 53 23 43%
1352 AAL-25-LGV AALADGLTALARLLASDDGALMLLALAALGV 108 11 10%
1353 LGG-28-VIL LGGALGIIAVLLRQEFLLVIMGGVFVIETLSVIL 57 30 53%
1354 AAI-25-TLG AAIQGGVLGGEVKDVLLLDVTPLSLGIETLG 58 37 64%
1355 VIE-28-LLG VIEMREITKKFGDFVANDHINLQVKKGEIHALLG 52 24 46%
1356 NAL-27-GAG NALNAALLLELGAALDGAAEDDDVRAVILTGAG 55 20 36%
1357 LDG-29-GLD LDGVLSSARALPAIADAVKGDIGILADSGIRAGLD 47 15 32%
1358 ILV-29-AAL ILVVDDVLTIGAVLLEGLAANVVSGFLAGDGLAAL 70 5 7%
1359 LVA-26-LGA LVANSIASQLELRVDFRRATKLAVQKAARLGA 93 24 26%
1360 LVA-24-GLA LVATTVIEVGVDVPNASLMIIENAERLGLA 100 30 30%
1361 ELG-27-DVL ELGVNLRQTSGPVIEKAGDLAALLTNLEPGDVL 55 25 45%
1362 AEI-28-FLL AEIRGHRRTYIGSMPGKLIQKMAKVGVKNPLFLL 41 34 83%
1363 ITA-24-LPL ITALFIPTGWLPNETLAKLVGPMITYLLPL 47 16 34%
1364 SLA-29-LAL SLAPTLALGLSVAAILEALGLGLAGTHGTTAALAL 101 17 17%
1365 GLI-25-LAE GLIVEILAAQLKKGLLDVGGKLRRLMPELAE 57 10 18%
1366 VAI-26-EIL VAIARALILDPEFLLADEPTSALDVSTRAEIL 50 28 56%
1367 AGL-27-SLG AGLQAIATAKRLGAVVTAADVRPAVKEQVASLG 69 20 29%
1368 AAL-25-LLT AALAAVLLAAGRTTDAVLMYAREAGTVELLT 103 15 15%
1369 IAL-28-SLG IALSLNGGAYIAEIVRAGIQAVPKGQMEAARSLG 60 28 47%
1370 IAA-29-ALG IAALSLLVAGLAAANLLLLAVALRTAALGLALALG 93 16 17%
1371 SVL-28-LLT SVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLT 56 21 38%
1372 ATL-24-ALL ATLLLAAATLAIGAALLAAATPALVAAALL 94 9 10%
1373 VLL-28-AIA VLLLIGALFLLLLALARAPLAVFFVLIALSGAIA 86 8 9%
1374 LTG-24-LAL LTGPVTILAWSFPREDILREAIAKQIALAL 89 28 31%
1375 LTG-24-GLA LTGITEPIEFAFMFVAPILYVIHAGLAGLA 78 17 22%
1376 VDL-28-GGI VDLDGAKAGESVNLALIEAILKATKIPVQVGGGI 44 30 68%
1377 TLA-24-LAA TLANIIANEMGVNLRTTSGPVLEKAGDLAA 113 42 37%
1378 LVA-28-VLG LVAGLSAGLAGALLIVGALAGAGLLEAGGLAVLG 81 7 9%
1379 GID-26-AIE GIDLVKEQIRIAAGEKLSLKQEDIKLRGHAIE 45 30 67%
1380 GLL-24-LAL GLLGALGLAVLLAGLIGAALEGGVGAGLAL 131 1 1%
1381 LLP-27-LLA LLPALLLGALVALPIILEFELRAGPIFTRILLA 101 21 21%
1382 GVI-24-VIL GVIGVIYEARPNVTVDAAALCLKAGNAVIL 49 23 47%
1383 LLT-27-ELA LLTQPEILMLDEPARGIDLGAKFEIYQLIAELA 70 12 17%
1384 IVG-24-LID IVGPSGAGKSTLVKLLARLYDPESGRILID 48 34 71%
1385 GVV-29-FLA GVVDAFRAAGLKIFGPTAGAAQLEGSKAFTKDFLA 49 18 37%
1386 LLV-24-VVL LLVVDSMGGQTALNVAVLFAEALSITGVVL 79 12 15%
1387 IAA-24-GLG IAANTLPQAFSRFKQADVIQLRAKGGRGLG 71 14 20%
1389 LFG-27-IGG LFGIVQGGGYEDLRRQSAKDLVSLDFPGYAIGG 51 41 80%
1390 ALN-28-ALK ALNGMQNLQRAKAAATAAINNALDLNQAQKDALK 49 24 49%
1391 TLG-26-GAG TLGEKGALASDGDELLRVPAIKVTVVDTTGAG 57 27 47%
1392 VDL-26-GLL VDLALGVGEGLGLVGISGSGKSTLLRAVLGLL 55 17 31%
1393 IVD-26-AGI IVDELADLMMVASKEVEDAIIRLAQMARAAGI 45 29 64%
1394 ALL-28-VLG ALLVLALLLGLLLLVLARLLGELGLTAALFGVLG 107 14 13%
1395 EVL-29-GID EVLATNGDTHLGGEDFDSRLINYLVDEFKKDQGID 45 28 62%
1396 ALV-26-LAS ALVAALARLALLALEAALLAAALLAALLALAS 81 3 4%
1397 ALE-24-LLR ALEGLELLLVYQPKVAALGGPGVGAEALLR 65 10 15%
1398 VEL-25-AAL VELGGGLKESIALALVLAAGLGGGDPAAAAL 79 8 10%
1399 VVI-27-LGG VVIGGLPGGIFIGIGAPLLLALGRLAQGAGLGG 52 8 15%
1400 LTG-24-VGK LTGKLREGATATDLVLTVTQMLRKHGVVGK 43 25 58%
1401 ITL-24-VLI ITLRGRVLPIGGLKEKLLAAHRGGIKTVLI 50 30 60%
1402 LGL-26-IAA LGLVPATVIFVALEPENVLGAATLVGFLLIAA 94 10 11%
1403 ILL-29-ASG ILLTSMDRDGTKNGYDLELTRAVSDAVSIPVIASG 52 44 85%
1404 GLG-28-LGL GLGIGSADLALIFDAFLRVDKAGLRALGGTGLGL 93 15 16%
1405 IAG-29-LSG IAGVPKAEIRKRVSELLDLVGLEDRADRYPSQLSG 61 42 69%
1406 TLG-24-ILG TLGGTGKEGGDRHPKIREGVMIGAGAKILG 52 28 54%
1407 IVV-24-LGA IVVVNKIDRPGARPDEVVDEVFDLFIELGA 58 39 67%
1409 LSL-26-GLL LSLALLLLLIVLLLGGVGAALLFLLGLIAGLL 91 12 13%
1410 LLE-25-VGK LLETGIKVIDLMCPFAKGGKVGLFGGAGVGK 46 26 57%
1411 GLG-28-DLL GLGAVPADHPLYLGMLGMHGTKAANMAVQECDLL 61 28 46%
1412 LVE-26-IVV LVEIIRGEKTSDETIATVVAYAKKMGKTPIVV 45 36 80%
1413 EVI-24-LIE EVIREHPVLLNRAPTLHRLGIQAFEPVLIE 48 33 69%
1414 LVL-28-LDG LVLDATTGQNALIQAKQFAEVVDITGIVLTKLDG 56 30 54%
1415 LLG-25-GIA LLGLEGGGFKIAMATLDGGRIGIAAQALGIA 75 20 27%
1416 GIS-28-AIE GISTSLPFDVQLQIVRSIKGLENAHIVRPGYAIE 44 33 75%
1417 GVS-24-VIE GVSASFAMLGDINIAEPKALIGFAGPRVIE 41 35 85%
1418 LLS-27-VLG LLSDATILALRLKAAAFIGVGTGLTAALAAVLG 75 7 9%
1419 NAL-29-GLS NALSGKGVHVVTVNDYLARRDAEEMGELYNFLGLS 52 27 52%
1420 LGY-25-LLF LGYMFVALGVGAYGAAVFHLMTHAFFKALLF 48 29 60%
1421 IAL-25-EGL IALALRDEVADLEAAGIKIIQIDEPALREGL 53 23 43%
1422 EGL-25-LAA EGLKAVKALSKEGIVTNVTLVFSALQALLAA 77 19 25%
1423 LAA-28-GVL LAASLQANGGALRVGRFLGELALGGALRLVAGVL 112 10 9%
1424 LGS-28-GLV LGSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGLV 54 24 44%
1425 LIA-27-AAI LIATLPTPVTSVAELHVLAIVGKRRAQAVLAAI 73 7 10%
1426 IAL-28-LVD IALEDALKLVELFYLPAPAYPAEETKHTIAALVD 53 8 15%
1427 DLI-28-VIA DLILMDIQLPTMDGAEACKLIKELPETGQIPVIA 48 21 44%
1428 AGL-27-ALE AGLDYPGVGPEHAGLNDIGRAEYVSITDDEALE 83 29 35%
1429 DLA-24-LVL DLASGRSTFMVEMTETANILHNATEQSLVL 58 32 55%
1430 ALV-24-LLL ALVAAATAVLPARLLGKLLGTGALAGLLLL 115 12 10%
1431 EVL-27-VLA EVLATCHDDAAALAVVIAGYVISMAGTMSDVLA 73 14 19%
1432 VGL-24-LAI VGLGAKADAYPSELSGGMKQRVGIARALAI 65 22 34%
1433 TGL-27-LID TGLLNRRAFDEELEEALADAERKGQPLALLLID 47 17 36%
1434 VDL-25-LEL VDLRDFRGPEVKEEKPEFDPILLRPVDDLEL 48 17 35%
1435 VLL-28-LGS VLLQGLIDGLLTDSQGRLVGFRNLLMGAAANLGS 62 16 26%
1436 VGL-28-GLV VGLDYLTLSRSAETLSGGEAQRIRLASQIGAGLV 63 29 46%
1437 IGA-24-VLF IGAYAGALELSSGGDLPEGHREIAGVVVLF 51 13 25%
1438 VLV-26-LLG VLVLGGGSLLDLGAMLVLLDALIPVLTALLLG 80 3 4%
1439 ALG-25-GLG ALGATLWEVLALDVLPAGRSAIAGAIALGLG 84 13 15%
1440 GIG-28-IGL GIGIPGSDAATLFKRFFRLDNSLLGSSGGAGIGL 65 7 11%
1441 TLA-26-ALG TLAEAGAAALGGVIASDGAAASLAAALLVALG 88 6 7%
1442 TGL-28-IDL TGLPNRRAILERLEQALDRARRRGLKLALLLIDL 46 28 61%
1443 GGG-26-LLP GGGLELALACDIFVAPTIASNGLPEASVGLLP 53 16 30%
1444 VLA-26-ALG VLADGLAYAAAAAPALIIDAATLTGAALVALG 104 25 24%
1445 LGY-26-GSG LGYEKPTPIQAACIPGILKGKDVLAQAQTGSG 41 27 66%
1446 LEA-28-IDL LEAGVHFGHQTRRWNPKMAKYIFTERNGIYIIDL 48 36 75%
1447 TLA-29-ALI TLAPVATVLGLAFKLLDPAGLLGGQENLGITCALI 64 16 25%
1448 ILD-25-LSA ILDLMLPDGDGIEVCREIRKTSHVPIIMLSA 49 31 63%
1449 IGA-25-LGG IGAGLGGRTAALRAASFGVKVGGTISGLLGG 67 15 22%
1450 IGA-28-LVA IGAGTITCNYDGANKFKTIIGDDVFVGSDSQLVA 69 29 42%
1451 DLA-26-TIA DLAQLIFDLKQVNPKARISVKLVSEPGVGTIA 48 35 73%
1452 ISG-25-GAL ISGGQKQRVAIARALITEPKVLLADEPTGAL 54 31 57%
1453 SGL-27-ALV SGLMLVAKNGLAHAGLAKQLTDKAIKKRYIALV 65 20 31%
1454 VIL-28-LAA VILMVGVNGVGKTTTIGKLAKQFQQEGKKVMLAA 65 38 58%
1455 IVL-26-GLV IVLGTSSSESALPRMLDKMEKLGCRKSVVGLV 57 21 37%
1456 LPL-26-LVS LPLIPVNGMAGHLFAAFAVAILVAPLIALLVS 60 19 32%
1457 LLG-29-IGL LLGCGVTTGIGAVLNTAKVLLGAPVAVFGLGGIGL 85 21 25%
1458 LTL-29-SLL LTLAGALYITFVCLIPEFMIVALIVPFYFGGTSLL 76 21 28%
1459 SAL-26-AAL SALAAAAAAAAAGAVAALLAALAAALAALAAL 107 4 4%
1460 SGI-28-SGG SGIVSALGRSGLNAEGYENFIQTDASINRGNSGG 47 33 70%
1461 LLL-24-SVL LLLLALTALLVAVLAAGLLAGLKLLLGSVL 91 3 3%
1462 LEL-25-ELL LELTVRSANCLKAEAIHYIGDLVQRTEVELL 69 29 42%
1463 GAG-28-LGL GAGLVVLPVHNGIEYADQQGISESYYPLRIGLGL 94 23 24%
1464 LDL-25-VSG LDLENLPRDGQGKLDFSKDFFGKESFLTVSG 48 18 38%
1465 LTG-25-LTI LTGGVDANALHRPKRFFGAARNVEEGGSLTI 47 41 87%
1466 IAD-27-DAL IADAFLQQILLRPAEYDVIATMNLNGDYISDAL 57 29 51%
1467 SLA-24-LLL SLAGPLILAVLGIIGLVLFFVMRAMGELLL 103 12 12%
1468 GGG-25-TLG GGGHAGTEAALAAARMGQKTLLLTHNIDTLG 53 21 40%
1469 VLI-29-TLL VLIVEDIIDSGNTLSKVREILKLREPKSLAICTLL 58 29 50%
1470 VIG-27-VEL VIGQDQAKKVLAVAVYNHYKRLRSGDKSDDVEL 48 26 54%
1471 ALA-27-ILL ALALLRRADYAFAVIPRLGVTVGGGGSVIAILL 91 18 20%
1472 GIG-28-TLL GIGRDEYNPDKLRYHRIIIMTDADVDGSHIRTLL 57 34 60%
1473 ALT-28-EIA ALTAIDINSARATRGGDIEETALNTNLEAADEIA 52 21 40%
1474 AAI-27-SLG AAIGAGLPVEEPTGSMVVDIGGGTTEIAVISLG 60 39 65%
1475 IAG-29-LID IAGATGSGKSVCINAILDSLLYKAEPDEVKLLLID 47 16 34%
1476 IPL-29-RLI IPLPTEKEVYTVLRSPHVYKDSREQFEMRTHKRLI 40 36 90%
1477 PLL-29-ALG PLLARVGIALVSLPGGCAIGSRPIDLHIHGLLALG 76 17 22%
1478 ISG-27-LDA ISGGMKQRVAIARALVLKPKVLLLDEPFGALDA 46 28 61%
1479 LVS-26-GGG LVSCFLLQVEDDMNSIGRSINSALQLSKIGGG 53 24 45%
1480 ISA-28-LIA ISATERALTILILLPPNVAPSDGIRPGHIFPLIA 55 23 42%
1481 IGL-28-ALG IGLALAAVARGLDLIVLAPELFGEEKLPVLKALG 76 13 17%
1482 VGL-28-GAL VGLVLLAGVLLLLLKSPAVTAIIIALGLNAIGAL 74 4 5%
1483 LGV-25-VIL LGVIGVIYEARPNVTVDAASLCLKTGNAVIL 54 29 54%
1484 AAL-29-LLG AALAGLAAALGLLLAAALAAALLAAAGALAAALLG 145 4 3%
1485 VIG-26-IAS VIGFGGKTIGAITEETGAKIDIEDDGTVKIAS 50 15 30%
1486 VLD-24-LLR VLDDISLEVAAGEFLALVGPSGSGKSTLLR 51 29 57%
1487 LGY-27-GVV LGYLLAGIAIGPWGLGLITDVDSILHFAELGVV 45 30 67%
1488 LLI-27-VGL LLIVLGTSSSESALPRMLLKMEKLGCRKSVVGL 61 20 33%
1489 ILG-25-LIG ILGPFLGIREGDIVKRTGKIMEVPVGEALIG 65 16 25%
1490 SLG-26-GIL SLGQFNLDGIPPAPRGMPQIEVTFDIDANGIL 50 38 76%
1491 IGA-26-IGG IGASGARLLVTLLLEMNGRDAKVGLATLCIGG 104 46 44%
1492 GLG-28-LLG GLGEIGKNTYGVEFQDEIIIIDAGIKFPEDALLG 91 22 24%
1493 GLV-28-AAL GLVLLLGLLGAIALTGEAQQLLDAAAVAPGLAAL 109 11 10%
1494 ILD-27-VLV ILDEPTTGLHTDDIARLLKVLDRLVDDGNTVLV 46 18 39%
1495 VDL-27-SVL VDLSEKGVSEAIAAGKLLKEAGIEFDLAYTSVL 45 28 62%
1496 ILL-24-GVV ILLSSDPLAGQDAGNIATVLFEQLSITGVV 57 9 16%
1497 EVL-29-AGI EVLESNGSSSQASICASTLALMDAGVPIKAPVAGI 52 26 50%
1498 SLG-24-LVE SLGLAPIIVQQIFDIIEQLREQGMTIFLVE 53 25 47%
1499 TLI-26-IGA TLIGAVTGEGAADAINGGKLQLAALGLQNIGA 50 37 74%
1500 ISA-27-GAL ISALGRSGLNLSGRENFIQTDAAINPGNSGGAL 58 23 40%
1501 AAL-27-IGG AALAAARMGAKTLLLTHNLDTLGAMSCNPAIGG 76 29 38%
1502 LLK-25-GIT LLKQSGTFREREEVAERAMDSNDLEKERGIT 45 28 62%
1503 ALL-25-DIL ALLVFDEVQTGMGRTGDLFAYMHYGVTPDIL 58 20 34%
1504 ALI-25-ALL ALISAAGIALLLAGLDALGAAPHPLDVKALL 99 10 10%
1505 LLG-24-LGI LLGLEGGGFLIAMLNLLAGRIGIGAQALGI 85 11 13%
1506 ALA-26-LLE ALAALPGLLLADEANGALDALALEEMLDELLE 107 7 7%
1507 ALG-24-GSG ALGKDIGGEPVVTDLAKMPHLLVAGTTGSG 63 39 62%
1508 SLA-25-LLT SLAITLATNNINVISQDLDPEIVKAAPSLLT 68 22 32%
1509 IVD-27-EAL IVDDEKEIRDEIEFNLEKEGYEVSTAEDGREAL 51 10 20%
1510 LLI-24-LTL LLIVDEEQRFGVRHKERIKALKANVDVLTL 68 37 54%
1511 LGF-24-LDL LGFGFRCGFLGLLHMEIIQERLEREYDLDL 47 29 62%
1512 LLT-28-LVV LLTAEEEVELARRAEAGDEAAKQRLAEANLRLVV 59 30 51%
1513 GLA-24-LVE GLAADGRCKAFAAAADGTGWAEGVGMLLVE 60 16 27%
1514 AAL-25-ELA AALGVLAADLARKVLALSGDGAFQFLLEELA 117 16 14%
1515 LLA-25-AIA LLASAAAALEVALLASLAPTAGALYVLLAIA 117 6 5%
1516 ELL-28-GLA ELLEGIGLAAKDGLAAASLPGGQAQRAAAGRGLA 68 8 12%
1517 GVL-28-GVG GVLHGARTYLLQDDDGQIPEAHSISAGLDYPGVG 58 22 38%
1518 GGG-28-NAL GGGNIFRGEPAAAAGMDRVTADYMGMLATVMNAL 49 33 67%
1519 VLG-29-AIG VLGVPVQSAALSGVDSLLSIVQMPRGIPVATLAIG 63 28 44%
1520 ALA-28-DLA ALAMAPKLMLFDEPTSALDPELVGEVLKVMKDLA 103 37 36%
1521 ASL-24-DAL ASLDYNFKRFQASDLVRVDILINGEKVDAL 69 32 46%
1522 LGL-27-LSG LGLSGRGAKLLLELLFEEGLAALANAEPAALSG 90 14 16%
1523 VLL-27-IGG VLLIDASAGHLEGVLQRIRDAIAASPLLGIIGG 61 11 18%
1524 AGL-26-VIV AGLVPRVDISGDTVRYGRIINRGCHSIRRVIV 56 16 29%
1525 SGG-26-GSG SGGGGSGGGGSGGGGGGGNGSGGGGGGGNGSG 78 62 79%
1527 LLL-29-VIA LLLDEATSALDAESETAVQEALERLMQGRTTIVIA 83 30 36%
1528 ALG-25-AIE ALGNLHEDDWEWHMYDTVKGSDYIGDQDAIE 55 18 33%
1529 IVL-24-LLG IVLPEGDEPRIVKAAAILVVRGIAIAVLLG 65 14 22%
1530 VGL-29-DIL VGLEGYADKYPDELSGGMQQRVGLARALANDPDIL 46 40 87%
1531 DVL-29-LSA DVLLVPAHSTVLPGDVDLSTQLTKNIRLNIPILSA 55 29 53%
1532 IGA-26-ELL IGALIVIEREIGLLAYIETGIPLDADISSELL 52 17 33%
1533 LGL-28-DLA LGLWHNFGADLPGESQRAILRLAFDLGITHFDLA 79 19 24%
1534 LVA-27-VLF LVAVISNGTAVLGLGNIGALASKPVMEGKGVLF 54 28 52%
1535 LEL-26-LLK LELTVRSANCLKAEAIHYIGDLVQRTEVELLK 60 28 47%
1536 ALA-29-LGV ALADLLHFLRAAAACGVSQPLLSAQIALLEAALGV 116 18 16%
1537 ILV-24-FGL ILVSTTVIEVGVDVPNATIMIIEDADRFGL 47 34 72%
1538 IDL-24-GKL IDLVAMCVNDLVVQGAEPLFFLDYFATGKL 45 31 69%
1539 GLV-25-GVL GLVLLLLSLSLLLLLAFLLLGGAGAAAIGVL 65 10 15%
1540 GVS-27-GVG GVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVG 54 30 56%
1541 LDG-29-LDV LDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDV 46 36 78%
1543 LGA-29-SIA LGAPYWDPYARGAIFGLTRGTNKEHIIRATLESIA 53 34 64%
1544 AGL-29-GLA AGLGAAAAALAADGVDAGLLEADALVLGAVPAGLA 106 12 11%
1545 ALS-24-LFG ALSYAKGIGGTRAGVIETTFKEETETDLFG 58 32 55%
1546 LAL-26-GEL LALGRLAKEDPSFRVKTDEESGQTIIAGMGEL 70 18 26%
1547 GVL-24-VIG GVLGWGVGGIEAEAAMLGQPSYFLIPEVIG 59 23 39%
1548 ILD-25-GEI ILDAILKQDPNARVACETTVTTGLVLVAGEI 47 35 74%
1549 TIA-24-ALK TIAIFINQIREKVGVMFGNPETTPGGRALK 45 16 36%
1550 LGV-27-FGL LGVIPALGAIAGIAIFGALVVDDSIGELALFGL 53 4 8%
1551 GLS-28-TLL GLSKILGEEAFGAQRPQVQERITQQALAALQTLL 63 11 17%
1552 LAI-24-LLT LAIELATNNINVISQDLDPEIVKAAPSLLT 61 16 26%
1553 GVL-25-AIV GVLASEGYTDNTLADAPYVLAIGGLLRDAIV 56 21 38%
1554 TLL-25-SVL TLLHDDVVDESDLRRGKATANALFGNAASVL 58 28 48%
1555 AGI-24-GID AGIEVILDVVENHGAEMASDGPTPSRRGID 46 21 46%
1556 GGG-27-LGA GGGAILAGASVALREFAEATGIPVTSTLMGLGA 77 34 44%
1557 NLL-29-LVS NLLILDEPTNDLDVETLELLEELLAGYQGTVLLVS 50 22 44%
1558 LIG-24-GFL LIGINLLREGLDLPEVSLVAILDADKEGFL 49 20 41%
1559 AVL-26-GIL AVLVIACPCALGLATPTAIMVGTGRAAELGIL 63 34 54%
1560 VAI-27-GIA VAIVGGSKVSTKLTVLESLSKIADQLIVGGGIA 54 20 37%
1561 LLN-28-AGI LLNQTFAPTAPNQVWVADLTYVATQEGWLYLAGI 49 29 59%
1562 ILV-26-LPL ILVIAVVVQFTEMVVRKTSPTLYRLLGIFLPL 49 17 35%
1563 VGI-26-GIG VGIVSRSGTLTYEAVKQTTDLGFGQSTCVGIG 48 23 48%
1565 AAL-29-GAL AALALGLVALLAAAQLAAASTTLLGALALAALGAL 145 6 4%
1566 GIG-29-LLL GIGRDEYNPDKLRYHRIIIMTDADVDGSHIRTLLL 86 34 40%
1567 IEA-29-LLS IEATSDCGAYVMVHGALKRLAVKLSKICNDLRLLS 51 23 45%
1568 VLL-25-GLA VLLAGTIVAAAIVHPLATALLINVGSGFGLA 96 13 14%
1569 VLV-25-GLL VLVMYAGRLMEPGGAGGIFVQPLHPAGAGLL 77 12 16%
1570 VSG-25-EVI VSGRGELHLSILIENMRREGYELQVSRPEVI 41 32 78%
1571 GDL-27-ALA GDLAPLAAVSSVAQGLAKADGIRFFFEAPDALA 76 14 18%
1572 LLS-27-ELL LLSSRTVAGNVALPLELAGTEKAERARRVAELL 77 25 32%
1573 KLA-29-LVD KLAEEDPTFRVETNVETGQTVIAGMGELHLDVLVD 47 22 47%
1574 AIV-24-AEI AIVRDAKVFLMDEPLSNLDAKLRVQMRAEI 48 37 77%
1575 GVI-27-ELI GVIDRKSVDQPVQTGYKAVDSMIPIGRGQRELI 43 29 67%
1576 VLL-27-VIG VLLAEAKVPYDIVLEMDEINDDFADTDVVLVIG 66 33 50%
1577 ALA-27-SGL ALARAASALLSTRLGGGLGPAVNAGLVAELSGL 88 12 14%
1578 GSI-28-VVL GSITSVQAVYVPADDLTDPSPATTFAHLDATVVL 44 24 55%
1579 IAA-29-VLL IAAPAAVSPLLVIVGAAYATALAEDFRDLGQLVLL 75 11 15%
1580 EIV-28-GLI EIVGYAMGERMTKELTGKALFMALRSQRPPAGLI 43 36 84%
1581 NLA-29-DAI NLAIVGRYVLSPEIFDLLEKTPPGAGGEIQLTDAI 41 33 80%
1582 VLD-26-LTG VLDEAQTIKNPLTLFSKAERSLAAGHRVALTG 52 14 27%
1583 IGV-28-ALI IGVEGGGAVKNVIAIAAGMSDGAGFGANARTALI 55 14 25%
1584 LLD-25-IGV LLDEPFAGVDPIAVLDIQQIIGHLKSRGIGV 48 23 48%
1585 LAI-28-DAI LAIIGRYLLTPEIFDILEKQKPGAGNEIQLTDAI 46 33 72%
1586 LDA-29-ELA LDAVANRVRINPTRAGAEKIRAEDAGSGELKSELA 73 15 21%
1587 TGL-28-GAL TGLTAVVVGLLFLLVIFLSPLAGMRPAYAAAGAL 61 17 28%
1588 AGL-24-LVV AGLQGAGKTTSVGKLGALLREYAKKGVLVV 79 15 19%
1589 FGL-29-ALG FGLPAEQIATDIGTNPAIKTATAIGITFRQFLALG 60 21 35%
1590 LLL-28-IAL LLLLGGGAVLLLALAPGLLGLLAASAALALAIAL 110 9 8%
1591 GLL-25-VLV GLLAGANAALLVQGLEAWAPRRDQAYLGVLV 79 21 27%
1592 GIA-28-IGG GIAIGITHGLTTTTSLSAAVLKELGIAYAFVIGG 54 18 33%
1593 AIG-25-ALG AIGAGALASGGNAAALGGAAQATADGSIALG 77 15 19%
1594 GGI-27-LIG GGISFGGLIAPHGAKRAVGSIALIMLIGSLLIG 59 8 14%
1595 AIG-24-ELA AIGLVRAGDGILIDIPAGDGGLLMSDEELA 59 11 19%
1596 GGS-28-GVV GGSAAAVAAGEVPFSLGSDTGGSIRQPAAFCGVV 51 28 55%
1597 LGG-24-ALG LGGGTFAISILRLARGVFEVLATGGDSALG 91 18 20%
1598 VGL-25-IAL VGLTAALAPRYPHEISGGVRQRLAIARAIAL 74 12 16%
1599 VGL-24-LAS VGLADAHDSYPSNLSGGQKQRVAIARALAS 62 23 37%
1600 VDL-27-LLP VDLVLCKGGNFGLVGASGSGKSTKRGGALPLLP 46 15 33%
1601 AGI-26-GGI AGIDVFDIEGDSVDPVKGIAQVKALEPTFGGI 55 21 38%
1602 DVL-27-GLG DVLDMTVEEALEFFEAIPKIRRKLQTLVDVGLG 53 31 58%
1603 AIV-26-GIA AIVGGSKVSTKLTVLESLSKIADQLIVGGGIA 56 27 48%
1604 IGV-28-VGK IGVDLDGSLPGGYTATDGALAVTQLLRKIKVVGK 39 22 56%
1605 NVL-29-IGA NVLLAEAKVPYDIVLEMDEINDDFADTDVVLVIGA 42 32 76%
1608 VSL-24-LGG VSLTGSVATGEAVASAAASGIKKVSMELGG 60 20 33%
1609 EAI-28-LGT EAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGT 41 31 76%
1610 ILD-26-LGL ILDVTADTATLGKTQGADQALGKSTYPALLGL 53 27 51%
1611 GGS-29-LLE GGSLRIHQKDLQERMFKALGFSAEEAQEQFGFLLE 49 25 51%
1612 SGV-27-AIV SGVLLPALSFSACVLLACQFALDSINKTYSAIV 45 18 40%
1613 VIG-27-AIG VIGDEIKAQILEAEGRLPDQLVACVGGGSNAIG 55 19 35%
1614 TLI-28-VEL TLIIAEEGAYVSYLEGCTAPGRDENQLHAAVVEL 41 24 59%
1615 GDL-27-IVA GDLGVEVPLEEVPLVQKRIIKAARENAKPVIVA 44 19 43%
1616 LGL-25-AIT LGLIRAVEKFDYTKGYKFSTYATWWIRQAIT 54 26 48%
1617 EAL-27-GKL EALGDLLKRLTPEPLDLLQGHAEAALIRRVGKL 58 11 19%
1618 EIL-26-VGK EILETGIKVIDLLAPYLKGGKIGLFGGAGVGK 49 32 65%
1619 GSL-29-TIA GSLTETLAAIKMAKDAGYTAVISHRSGETEDATIA 43 28 65%
1620 VLT-25-EAL VLTPADDEFHIDKWEFTVPFVCGARNLGEAL 57 21 37%
1621 GIE-26-LGL GIEPDHLPRIFERFYQADLSRTRDTGGTGLGL 53 24 45%
1622 IAG-24-LAI IAGLYVAADLLSIIGYLLVSLIRDEDGLAI 58 8 14%
1623 IVS-26-SGG IVSALGRSGLNAEGYENFIQTDAAINPGNSGG 44 33 75%
1624 LGT-26-GSI LGTMGFGLPAALGVKLALPDETVVCVTGDGSI 42 24 57%
1625 GVV-25-LGI GVVHVDGSKSFVAADIPGLIEGAAEGAGLGI 56 17 30%
1626 LGL-27-AIG LGLEAAGVALALRGLVEIDLQLRTNVPGIYAIG 76 18 24%
1627 LLA-26-YLL LLARLLFGGKAAVLLALLLLLVLPPLVLGYLL 69 8 12%
1628 AIA-26-VVL AIAGAGPLVGPVLAAQMGYLPGLLWLLAGVVL 74 16 22%
1629 IVG-26-AGL IVGYAMGERMTKELTGKALFMALRSQRPPAGL 63 36 57%
1630 IGA-24-LLG IGAAIGLAGHLLAAASFGVEGSALPRLLLG 70 9 13%
1631 LSG-29-IAA LSGLLAAFAGILLAGRLGSATNNLGFGYELDAIAA 66 26 39%
1632 AAL-26-AIV AALMMQLGADGVFVGSGIFKSGNPEKRARAIV 81 33 41%
1633 VLG-29-LVL VLGMAQTGSLKTAAASLPLLLALDLELAAPQILVL 79 15 19%
1634 VGL-24-LVA VGLLHGRMAQAERLRILAQFKQGELDLLVA 78 25 32%
1635 AIG-27-LVL AIGTAHGLYAGEPKLDFERLAEIRQAVDVPLVL 74 25 34%
1636 DLV-25-ALA DLVGLADKADAYPAQLSGGQKQRVAIARALA 77 28 36%
1637 GLI-24-IGG GLITPSLDEMVHVAKEMERQGFDIPLLIGG 52 28 54%
1639 VLL-26-LVI VLLAEAKVPYDIVLEMDEINDDFADTDVVLVI 69 23 33%
1640 LSG-29-AIT LSGGMLQRSAIARALDAYAIILILDEAFGALDAIT 48 12 25%
1641 GLS-27-GLD GLSGGQRQRLALARWLLITGPISLLDEPTEGLD 53 12 23%
1642 DVL-26-VLV DVLALLESLTLVDGDALSDVDVLVESEVLVLV 59 16 27%
1643 LAL-29-LLS LALDAAALALLAALLLLLLAALLLALEDLIARLLS 105 8 8%
1644 ALE-27-LLE ALEALGRGAAVARVEEALLLLELGIELAILLLE 73 6 8%
1645 LLE-24-GIA LLETVGLSLEHANRYPHEFSGGQRQRIGIA 54 19 35%
1646 VID-26-DLA VIDVAGGDKIPRKGGPGITKSDLLVINKTDLA 46 20 43%
1647 ILA-26-LAS ILALNAAVEAARAGEQGRGFAVVAGEVRLLAS 65 21 32%
1648 ALL-26-AVL ALLALLGALLAAALAALLALLLAVLAAGAAVL 133 2 2%
1649 GAL-26-AGL GALAVALAVVVALEVGAQGGLGVATSLAAAGL 98 11 11%
1650 LGV-26-GLS LGVIGALLATTLRGLPNDVYFQVGLLTLIGLS 64 27 42%
1651 AGL-26-ILV AGLEVLRIINEPTAAALAYGLDKTDKDQKILV 60 34 57%
1652 LVG-26-LLD LVGAPPGYVGYEEGGQLTEAVRRKPYSVILLD 63 40 63%
1653 AGI-29-IAA AGIVGALLEAVAVACPNACVGIGTGPVNTTVAIAA 70 13 19%
1654 IAG-26-ASG IAGVVTEVCVAFPALSALAEGFDVFVVTDASG 57 22 39%
1655 LGT-24-GLV LGTSSSESALPRLMEKMEKLGCSKSVVGLV 53 31 58%
1657 LLG-26-AAI LLGITKASLLTASFLSAASFQETTRVLTDAAI 88 24 27%
1658 VLL-28-VAL VLLLLQLGTGLGLAAARALLVGLVVGLLLAAVAL 88 4 5%
1659 LVL-26-VAL LVLADALALAERAAPALIIDSATLTGAAVVAL 86 18 21%
1660 GVG-29-IAV GVGSTHPEFLQRAVNATVWDVEGAFDGDFARGIAV 54 32 59%
1661 LGV-28-AIG LGVPVQSKALSGVDSLLSIVQMPAGIPVGTLAIG 63 28 44%
1662 IGG-29-AGI IGGNEDAATLKGELAPITKIKAYVLSGIDALAAGI 57 28 49%
1663 NLL-26-ELA NLLALNAGVEAARAGEAGKGFAVVAQEVRELA 52 35 67%
1664 LLG-26-LVD LLGTFAVLAAFGFSINTLTMFGMVLAIGLLVD 58 33 57%
1665 LLP-26-IGL LLPNLARVIIPKMTLELLNLLKNSAPLSTIGL 58 11 19%
1666 IAD-29-ALL IADRVMVMYLGRAVETGTAEQIFNAPRHPYTQALL 60 26 43%
1668 GIL-29-ILL GILSFVLKGGGLISLNISLLGDALWALIGLIGILL 64 10 16%
1669 LAL-25-ALV LALLVGALAAALLGAALALILSSVAAAAALV 124 9 7%
1670 ALI-27-AAL ALIGAGGLGLLILLGIARNALRLILLGAILAAL 100 8 8%
1672 LIG-29-LAI LIGAGGLGSFILLGIDRNAISLILIGAIVFALLAI 67 16 24%
1673 AVL-24-AGI AVLGLGNIGPLAGKPVMEGKAVLFKKFAGI 69 28 41%
1674 VIA-24-VLV VIAAGGGLNDELLLELLLSLLDGRRGAVLV 61 7 11%
1675 LFG-29-LLA LFGHHFAAAAGAGPLGGPVLAAQMGYLPGAILLLA 71 13 18%
1676 IGG-27-NAL IGGMVLHQGKIAEMRTGEGKTLVATLPVYLNAL 43 31 72%
1677 EVI-27-GGG EVITGFRFAYGGAQELLGVAPDLTALGKIIGGG 43 26 60%
1678 GEI-26-VLI GEITLRGRVLPIGGLKEKLLAAHRGGIKTVLI 40 34 85%
1679 ALG-27-LSV ALGGALGTIAVLLRQELLLVIMGGVFVVETLSV 61 36 59%
1680 LEA-24-GLI LEALVRWQHPERGLIPPDEFIPVAEESGLI 50 16 32%
1681 AIL-27-LLG AILATLGGAMSLELALLALSILLLAELLILLLG 79 1 1%
1682 LDV-27-GVG LDVSLRGAVSIARRLQDPLAELVKIDPKSIGVG 45 31 69%
1683 LVL-26-GLL LVLAITFLVLAAIGIVLLRISLGALIIALGLL 96 17 18%
1684 ILL-27-LLN ILLTLLGALSGLALELFLLGVAGLGGAISTLLN 59 8 14%
1685 GIS-24-AGI GISPREALAMDPQQRLLLETSWEAFERAGI 52 36 69%
1686 LLP-29-LLL LLPLALLLTEALIILLTLLLLVAAIRAALALALLL 93 7 8%
1687 GAL-24-DLL GALNRVIANANFTGRLITIDFVREALRDLL 61 22 36%
1688 LLA-28-LIV LLATWLRGLLNDVYFQVGLLTTIGLSAKNAILIV 80 30 38%
1689 LAE-28-LGA LAEYAAGRTPAPDVLINAEIKFKAALLAALELGA 78 15 19%
1690 AGL-24-GIA AGLANALKLTGKKVSAIKVVLNGAGAAGIA 78 17 22%
1691 LAE-27-ELG LAEMAHFGRAADSCHIAQPGLSAQIALLEEELG 65 15 23%
1692 ELL-29-GLV ELLIVLGTSSSESALPRLLEKMEKLGCRKSVVGLV 60 30 50%
1693 LLI-29-LVV LLILLGGLILELALALAVEKALLLGLLLLAGGLVV 64 8 13%
1694 GLS-28-AIE GLSTSLPEDVQRDMLRSIPGLENAEMMRTGYAIE 51 35 69%
1695 IAG-25-AIT IAGSDSGGGAGIQADLKTFAALGVHGLSAIT 48 27 56%
1696 LFG-29-GLA LFGIVQGGVYEDLRRISAKGLVAIGFDGYAIGGLA 59 33 56%
1697 VLL-25-LSV VLLIPLVFTVARRAGLSLLYIGIPMVAALSV 63 19 30%
1698 LLV-28-LLS LLVGAAAGLTVVLALILLIFPLLGLRLLALVLLS 86 7 8%
1699 LSA-26-ELL LSAKGSEDDKVIGLEAGADDYLTKPFSFRELL 68 27 40%
1700 VGI-27-IGG VGIVSRSGTLTYEAVKQTTDEGFGQSTCVGIGG 48 23 48%
1701 LLT-28-ASG LLTSMDRDGTKNGYDLPLTRAVSDAVNIPVIASG 53 37 70%
1702 GLS-28-LDA GLSPTPCLELVRRAAAQGAAAGLTALLNPAALDA 58 11 19%
1703 DVL-28-LGY DVLDMTVEEALEFFEAIPAIRRKLQTLVDVGLGY 40 31 78%
1704 IGG-29-LLE IGGGMTYTFTKAQGIEIGNSLVEEDKLDRAKKLLE 54 16 30%
1705 AAL-28-GAG AALFAAAARLRAILSAVAAAILGAVALALAAGAG 116 15 13%
1706 AIA-25-IGV AIAAVVLGGTSLAGGEGRIVGTLIGALIIGV 56 17 30%
1707 AAI-29-GAL AAIAAVYIVLGLLYESAVGPLAALAALPSAGAGAL 73 13 18%
1708 GAG-25-GLI GAGTSGRLGVLDASECPPTFGVPPGLVVGLI 60 23 38%
1709 EGL-25-LIA EGLAQRIVNGDVPESLKDKRLLSLDMGALIA 51 39 76%
1710 VLT-29-SGL VLTVGAAPILASAESAIRVFAQEIRLGKIGMVSGL 47 10 21%
1711 LLS-27-GLG LLSAVRAGLALSLAGRAGRVVFLLAAAFLSGLG 69 6 9%
1712 GAS-27-ALG GASKFQAFFKIVLPLAGPGILTGFILSFARALG 66 23 35%
1713 AIL-27-ADL AILRVHAKNKPLAEDVDLKAVAQQTPGFVGADL 53 23 43%
1714 IAA-24-LVV IAALANLLLLLLAASLAGLLGLVVLELLVV 64 6 9%
1715 IVS-24-GIG IVSRSGTLTYEAVKQTTDEGFGQSTCVGIG 44 32 73%
1716 GLL-25-GIG GLLEPTSGEVYINGTALGLDSPLKAALLGIG 65 10 15%
1717 VLA-29-LAL VLAVLLLAAAALAVFVGGALLPALGLALLALLLAL 122 5 4%
1718 GLG-29-LLI GLGAVEADFPLKLGMGGMHGTYAANAAVTECDLLI 59 18 31%
1719 VSL-25-GVG VSLRGAVSIARRLQDPLAELVKIDPKSIGVG 48 30 63%
1720 GLL-27-IAA GLLAGLAGIGLAARLSSALPAAGAGLELDAIAA 88 25 28%
1721 LGI-27-LAI LGIATGMDLAQATRADTSKSIGFILWIIAELAI 67 18 27%
1722 AAL-27-LLI AALGRVSILLGGLPGAALLGLRLLGAALGALLI 91 1 1%
1723 LLT-26-VIA LLTSMDRDGTKAGYDLALTRAISDAVSIPVIA 57 30 53%
1724 GIV-29-LLK GIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLK 49 37 76%
1725 SLL-25-SLG SLLAGVGELIAKGVMGFGKTIKILTVAASLG 65 14 22%
1726 LEA-29-GVV LEAIVHILPLPKPPVPGPLKALIVDSWTDQYLGVV 53 19 36%
1727 GIA-26-GAG GIAKHGAKLVTAVACARVPKFTVIIGGSYGAG 58 23 40%
1728 GAG-27-IGS GAGATFPAPVYAKWADTYAKETGNKVNYQSIGS 48 19 40%
1729 VLL-29-LAA VLLAVIAALYAVYAGPQGLLLIALRVHRLAAILAA 129 19 15%
1730 LGG-28-LLD LGGRAMEIVYDEADLERYFREAVSVSNDSPVLLD 67 29 43%
1731 LPL-27-GAL LPLILALLGRVLDGAGAADAGALTAGPGLTGAL 71 13 18%
1732 VGI-26-GLG VGIPAKALVRLFDPFFQVDTGVQRAFGGTGLG 53 14 26%
1733 VGL-26-GSG VGLDYLTLSRSAGTLSGGEAQRIRLASQIGSG 50 34 68%
1734 ILL-28-GDL ILLLPKDPNDDKNIILEIRAAAGGDEAALFAGDL 47 30 64%
1735 AGL-26-ALV AGLALLLLALAVAPIGLELGSAGAGAIALALV 104 11 11%
1736 ALV-25-LLR ALVNAPRLLLLDEPTLALDATVAAGVAALLR 72 11 15%
1737 GLS-26-EGL GLSKSYRVAGFRVGWMVLSGPKKHAKGYIEGL 53 27 51%
1738 VLV-28-LSL VLVLTILAIFAADLLAGGLALLVGLLIVVIGLSL 67 14 21%
1739 GGI-29-IAD GGIFTKAADVGADLVGKVEAGIPEDDPRNPATIAD 41 22 54%
1740 GAS-27-LLG GASTCDLAILLIDARKGVLDQTRRHSFISSLLG 62 25 40%
1741 GAS-29-IGA GASDMSGWLLMGLPGAVYASGLSLGWIAIGLTIGA 50 11 22%
1742 LLD-29-LLS LLDLPPGKLEVVLYFEKAELEDPGLTLLELRKLLS 71 22 31%
1743 LLD-28-AIG LLDINDLGLPAATEFLDMITPQYLADLISWGAIG 51 20 39%
1744 LAK-24-ALE LAKLLKAGGNVLLLDEPTNDLDIETLRALE 61 25 41%
1745 IGV-25-LLR IGVLIDDLVTKGTNEPYRMFTSRAEYRLLLR 47 27 57%
1746 VSV-25-IEA VSVTERTREIGIRMAVGARRSDILQQFLIEA 41 26 63%
1747 LGI-25-GLG LGICGGVQMAGESMADPLEELGAEEGDGGLG 65 14 22%
1748 SLL-29-GLD SLLPRWRGAAPIQRAIEAGDAETGVTIMQMDEGLD 51 36 71%
1749 IAL-24-LTG IALHYVFDSPADKLIWDVGHQGYPHKILTG 60 20 33%
1750 VVS-27-LVG VVSMLNSYSGWAAAAAGFMLSNDLLIVTGALVG 52 28 54%
1751 LSV-24-EAI LSVLETPPNNRVPDQLIACEDNLGGFPEAI 48 27 56%
1752 IGL-24-GEI IGLIKAIDRFDLSRGVKFSTFAVPMIIGEI 45 30 67%
1753 GEI-29-GDL GEIVVRGPNVMQGYYNNPEATAAAFRDGWFHTGDL 44 33 75%
1754 LLA-25-LVE LLARQVGVPYIVVFLNKADMVDDAELLELVE 81 39 48%
1755 LLG-28-GIG LLGCGVTTGLGAVLNTAKVEPGTLVAVFGLGGIG 69 15 22%
1756 TLL-26-VAL TLLLTLLATRGAILLGKGEIGEGQLEGLLVAL 77 6 8%
1757 ITA-29-ALA ITAIYDAAAAAREYGKTIIADGGIKYSGDIVKALA 67 19 28%
1758 LGA-25-GAG LGAAGALLVNAGGELAAGAPLVDVVGTTGAG 77 11 14%
1759 GLG-29-FLG GLGPIGAIYQARFLKYLENRGLKDTSKQTVYAFLG 49 31 63%
1760 ELV-24-ALG ELVEGASNEFDSELFLAGELTPVFFGTALG 60 15 25%
1761 VLG-29-LSG VLGLSKAEALARAEALLERVGLKDKADAYPAQLSG 69 35 51%
1762 LDI-28-GGI LDITASHEGRETMIDVVERTAEKVFIPLTVGGGI 43 33 77%
1763 VLL-28-ILA VLLANIASLYAVYHGPLGLQRIANRIHRLAAILA 84 16 19%
1764 ELG-28-LVA ELGEIEAVLAQHPGVREAVVLVREDAPGDQRLVA 59 34 58%
1765 VLD-27-LIV VLDEPSIGLHQRDNDRLIETLRRLRDLGNTLIV 46 28 61%
1766 ADL-29-GIV ADLRIDTYRASGAGGQHVNKTDSAVRITHIPTGIV 46 26 57%
1767 DLV-24-ILV DLVERTIEPLRQALKDAGLSVSDIDEVILV 41 36 88%
1768 GKL-26-GIG GKLQVELAQLKYLLPRLVGGGTHLSRQGGGIG 46 40 87%
1769 AIS-24-GGG AISGVLLGGKLRLDEFGVLVLGVVTALGGG 47 13 28%
1770 VIV-24-LVL VIVQIDKEERGNKGAALTTFISLAGSYLVL 53 18 34%
1771 LFG-27-GIG LFGAYQPEAGEIKVGGRPVAIKSPLAAAALGIG 52 19 37%
1772 GSG-26-IDL GSGGVMLPNHSPLVIAEQFGTLEALYPGRIDL 43 29 67%
1773 GVL-24-IGG GVLLAVPGADFVLHNSLFLIAHFHNVIIGG 58 23 40%
1774 VLG-28-LAL VLGIDNLVFIAILANKLPPDQRDAARLIGLALAL 101 22 22%
1775 LGI-25-AAI LGITKASLETDSFLSAASFQETTRVLTDAAI 62 24 39%
1776 AIL-27-LAS AILFLKLPPETRDRARLTGLGLALLMRLGLLAS 66 12 18%
1777 VIA-25-SGI VIARPQGGNNAGHTIIADGKGAKLHLIPSGI 50 15 30%
1778 GLG-28-AFL GLGPIGAIYQARFLKYLEHRGLKDTSAQTVYAFL 52 26 50%
1779 LGA-27-LSL LGATPLKVFFLITLPLIAPAVAAGWLLAFTLSL 77 25 32%
1780 GLA-27-ASG GLAGGTSRIEAVLGVFAAVAAPLGVTGVVLASG 68 14 21%
1781 DAL-29-LVD DALSDVDVLVESERLVLVDSLNDVLVLFESLSLVD 53 17 32%
1782 IGA-26-ITA IGAVHSVVFGGFSPEALADRIIDAQSKLVITA 44 35 80%
1783 GVS-27-LLG GVSAALVVLLLGLRALLIPNVTGLAVQFFVLLG 61 10 16%
1784 GVL-29-LTG GVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKLTG 57 25 44%
1785 LTG-26-TLG LTGILVEDDDDAAKAAQVLHAKGIATVLITLG 51 15 29%
1786 VIL-27-LLN VILRNDLENPGWYAAYTPYQPEPGQGRLESLLN 45 15 33%
1787 IGL-25-ALL IGLLASLLARELGGGATRGLLPLLAAVGALL 91 3 3%
1788 IVV-29-LLA IVVDPMGATELSAIAIIAALAGGKLVVTAFLALLA 69 13 19%
1789 VLG-29-AAL VLGDRLGGLVIAGGLLRAALGWLNIGAAVAALAAL 116 16 14%
1790 ILG-24-AIV ILGLTEYLDRKPAALSGGQRQRVALGRAIV 53 31 58%
1791 GGG-24-LIE GGGIAYNEEELREITERGLKLSPVTQCLIE 49 32 65%
1792 GID-28-IGG GIDYVIPDYTYLVENQDKIKGLFITHGHEDHIGG 43 30 70%
1793 AGI-25-VLG AGIILASRLGSAQPTAGTGYELDAIAAVVLG 63 24 38%
1794 AIG-28-FGL AIGDQLTCIFVDNGLLRLNEADQVMDMLGDKFGL 47 24 51%
1795 GVV-28-LIV GVVTRPFSFEGRRRATQAEQGIAALKEAVDTLIV 48 28 58%
1796 ALA-29-TGL ALAPVTLGVSATLGGGGAATSALAAAAAGVPGTGL 85 1 1%
1797 GVI-29-AAL GVIGGGLAGAAVLALLIGALLALLATDRGPLIAAL 78 12 15%
1798 VGL-28-LGG VGLAPAASASAGASASLLSILRMIISGAVAGLGG 63 10 16%
1799 LLF-28-GLG LLFGFGILLAGGCGTGPKLLALYGTTAYRAAGLG 56 15 27%
1800 ITL-24-LAK ITLPDGSQRHFDHPVSVMDVAQSIGAGLAK 50 23 46%
1801 LFG-28-VLG LFGAEYANVQPHSGSQANMAVYLALLEPGDTVLG 53 24 45%
1802 LGG-27-AGI LGGTIGVGLFLGAGSTIFWAGPSVLLGYLAAGI 64 13 20%
1803 IGA-27-IAL IGAAMIWDAEKAGVLLKGVELVEPTSINTGIAL 62 14 23%
1804 DLA-27-EAL DLAAGTSSASSKLIHGGLRYLEHYEFRLVREAL 68 21 31%
1805 ALA-27-VGK ALAILSALSVAELAQAIEAEDASTLVGFPGVGK 53 23 43%
1806 AIL-27-SAL AILLALGLSLLVIIRALLLMLLGLGILILISAL 64 13 20%
1807 SAL-29-TIA SALDSEVEAAIQESLDELMQGKTVIAIAHRLSTIA 48 28 58%
1808 IGG-25-IAG IGGRPGGAITAGCFLSRFTKKYLWAHLDIAG 68 22 32%
1809 GDL-28-GLD GDLDQRKRLRVLRDFKNGSIDVLVATDVAARGLD 44 35 80%
1810 AGL-27-GIE AGLKRLGLEDRIRAALPPEVSLPAVGQGAVGIE 52 27 52%
1811 LVA-29-LVV LVAAAALGAADAALAAAVAAALLALGAAGALVLVV 70 9 13%
1812 DLV-29-DLV DLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLV 47 20 43%
1813 IVS-24-VSG IVSEVTGELKKGLNAVDVLPATFPAGTVSG 42 19 45%
1814 AIA-25-LGV AIAEVQKAGGGAAFIDAEHALDPSYAAKLGV 75 25 33%
1815 AIL-25-AGI AILGVPINGLSPEIAAEVTAGGREACKVAGI 58 12 21%
1816 GLG-29-VLL GLGDLADNYPAELSGGQQQRVALARALAGEPAVLL 76 28 37%
1817 EIL-27-LGL EILPNILSAVVILLGVVVAGAILLEEELSFLGL 64 17 27%
1819 IAD-28-VGL IADVLDMTVEEALEFFEAIPKIRRKLQTLVDVGL 44 31 70%
1820 SGG-26-AAI SGGALAIGVGDGLMMLENSVYSVISPEGCAAI 56 14 25%
1821 ELA-27-GSG ELALLADTAGATVREALRQKRDEGDLGTRIGSG 53 18 34%
1822 LGA-28-ALT LGAIKYYTSYTLLTFDGKRYLLAALDRVCMVALT 74 13 18%
1823 KLA-29-SGL KLALAGPSVAEVDTYSRGDLGAATLLALFVEISGL 48 7 15%
1824 LFG-25-LLD LFGHEKGAFTGAIAARAGKFEQANGGTLLLD 47 26 55%
1825 GLL-26-VIA GLLSGVAGALLALRALASLLAAGVGLALLVIA 67 7 10%
1826 SAL-29-LGV SALDVSVQAQVLNLLKDLQKAPGLTYLFISHDLGV 66 29 44%
1827 GVI-25-AFL GVIVLTDPDIFGERIRKLILIAVPDRLHAFL 44 15 34%
1828 IVD-26-LGL IVDHFTYVFMGDGCLMEGISHEACSLAGTLGL 47 23 49%
1829 IGL-29-LLA IGLSVPHIARLLAGTDLRLLLPLSLLAGAFLLLLA 89 19 21%
1830 VAI-27-VLN VAIARALAMNPEIMLFDEPTSALDPELVGEVLN 38 31 82%
1831 GEI-28-ELL GEIQINIEESVRGCDVFIIQSTSAPVNDNLMELL 54 30 56%
1832 LLA-29-LLI LLAALLAGLLALVANGPALFLILAILAALLAALLI 105 2 2%
1833 LLD-27-VLI LLDEPFAGVDPISVIDIQRIIEHLKDRGIGVLI 51 38 75%
1834 VGL-29-EIL VGLADFEDVYPAQLSGGMKQRVAIARALAHDPEIL 51 26 51%
1835 IEA-28-RLL IEATSDCGAYVMVHGALKRLAVKLSKICNDLRLL 50 23 46%
1836 SIA-24-IVS SIAFAGKGQHQDAGAKMIHNAPNTSSTIVS 40 25 63%
1837 LDV-26-AGL LDVRDRAAVETAAASLPAEVRAIDVLVNNAGL 54 12 22%
1838 GLS-28-LGA GLSAVAAAVAAGARRIIGIDINVAKLALAARLGA 72 15 21%
1839 LGL-25-GAL LGLDFITEGAILFAAADPLLVLPPARLLGAL 99 12 12%
1840 ALE-26-AIA ALEALKKVGLEDRADRRPSELSGGQKQRVAIA 74 30 41%
1841 VLI-25-VAI VLIPGALAPKLVTRLMLLVMKPGSVIVDVAI 48 15 31%
1842 LGL-24-DIL LGLLISDEEHRFGVRHKEKIKANRGNVDIL 52 21 40%
1843 IAG-25-AIL IAGILIPALKHAVIALGLIAGAGKTRSKAIL 58 9 16%
1844 LLG-25-LLS LLGNIGGAGGGLNALGGLENIAAATLLGLLS 92 11 12%
1845 ELL-26-SVV ELLIVLGTSSSESALPRMMDKMEKLGCKKSVV 46 27 59%
1846 VLA-27-VLL VLAMLATATLVGASSFLGGLGAALIAGLGRVLL 96 13 14%
1847 ALK-28-ISG ALKGASLTIRQGEIFGIVGPNGEGKATLLAIISG 43 12 28%
1848 DAL-29-LLG DALPIQEETGLPYASKVPGKMHACGHDGHTAMLLG 72 44 61%
1849 LAE-28-LGY LAEIQNDRLLMQYDTIIIDEAHERSLNIDFLLGY 49 27 55%
1850 ALT-29-ALG ALTDAVLLLPLGIAAAEARLGVIPVIAVGGSLALG 82 11 13%
1851 GIS-24-LDG GISLTFSIVPKALGKEDDEQVDNLVGMLDG 41 28 68%
1852 IVV-27-GAL IVVVENVERVMSEEGLPPREATRKSMGQIQGAL 54 31 57%
1853 IAL-26-LGA IALLAEQTGEGTPAAVLEAALAAALHLEALGA 78 16 21%
1854 AIV-25-EIA AIVRDPKVFLMDEPLSNLDAKLRVSMRAEIA 45 28 62%
1855 LDA-28-ELV LDALAREIAAVILVGGLGLLLRADHDLAALRELV 52 7 13%
1856 VDL-24-IAG VDLDIASGEFVVLLGPSGCGKSTLLRMIAG 43 37 86%
1857 IGL-29-DAI IGLHQRDNERLLGTLIHLRDLGNTVIVVEHDEDAI 42 30 71%
1859 ALK-26-VGL ALKTLADNEGYETFVIPDDVGGRYSVLTAVGL 51 17 33%
1860 VIL-27-IGL VILPQALKLMIPALINKFVILLKDTSLVLVIGL 56 13 23%
1861 ILV-26-LGI ILVPGGFGDRGVEGKISAIQYARENKVPYLGI 55 28 51%
1862 ITL-25-LGI ITLAPVATVLGLAFKLSDPDHLLGLEEDLGI 48 16 33%
1863 AIA-27-LGA AIALLLSGLLAGVPDALLGALLAASLGALLLGA 89 6 7%
1864 GAL-28-LPL GALAGVTGVLIGLSGAGVYSALPDAVLDAAGLPL 70 10 14%
1865 LLF-24-LAI LLFLDAEDPGKDIYLYINSPGGSVSAGLAI 58 24 41%
1866 LAI-24-LIA LAIFTGQIAAALAAGNAVLAKPAEQTPLIA 66 19 29%
1867 ALT-27-LGL ALTGKGVHVVTVNDYLALRDAEGNGLLLEFLGL 81 20 25%
1868 EAL-26-AIG EALLAVADKTASLIITGNGDVIQPENDLIAIG 55 22 40%
1869 VIA-24-GGG VIAGQGTIGLEILEQLPDLDRVFVPVGGGG 53 36 68%
1870 LLA-25-FLA LLASVIALLLALLSRILGLLALGILFSLFLA 71 4 6%
1871 ALS-27-GLL ALSGGVDSSVVAVLLHGAIGAQLFCLFVDHGLL 82 16 20%
1872 VLA-27-LLI VLAVLVSLAALRLLAGGVELIDVILGIFLGLLI 76 6 8%
1873 VGI-28-ALL VGIENRPAIVDQKSRIGDWEADTIVGKGQKSALL 65 15 23%
1874 VLF-24-TLL VLFDNINLQIDEGDRIALVGPNGAGKSTLL 47 23 49%
1875 TLI-29-ELV TLIIAEEGAYVSYLEGCTAPERDENQLHAAVVELV 43 18 42%
1876 DIL-28-LIE DILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIE 44 28 64%
1878 GLA-29-LGG GLAGALLALALGFGLPSERSPAAGLEASLIVLLGG 77 5 6%
1879 DLI-25-GIG DLITTPGLINLDFADVKTIMSNKGSALMGIG 42 29 69%
1880 YGL-27-LVS YGLPQADLIQEGNIGLMKAVKRFNPEVGVRLVS 39 26 67%
1881 ELL-28-VGL ELLIVLGTSSSESALPRMMEKMEKLGCRKSVVGL 54 29 54%
1882 VAI-25-LGI VAIGAAIQGGVLTGDVKDVLLLDVTPLSLGI 52 29 56%
1883 LLS-25-LAS LLSTLKETPADAEVGSALLMLRAGMIRKLAS 73 11 15%
1884 VLA-24-VIA VLAGKDYGVGSSRDWAAKGTALLGIAAVIA 64 10 16%
1885 TIA-25-LTG TIALHYVFDSPEDKFVWDVGHQSYPHKILTG 45 23 51%
1886 VGK-29-IGA VGKNCHIGAGAVLAGVIEPPSAIAIVVGDDVLIGA 41 10 24%
1887 DLV-24-VLV DLVYMTEAEKIAAIIEDIKERTAKGQPVLV 50 19 38%
1888 LGY-28-LAA LGYMIVALGVGALGAAVFHERTHALFKALAFLAA 58 12 21%
1889 GAL-27-VGL GALKQLAAGEGYETFVIPDDVGGRYSVLTAVGL 68 17 25%
1890 SGG-24-LTI SGGVDPNALHKPKRFFGAARNIEEGGSLTI 42 37 88%
1891 GIE-25-GLG GIEPDHLPRIFERFVQADSSRTRATGGTGLG 47 23 49%
1892 AAL-26-GIA AALAEAVLAEARGLIARPDALIAATLALAGIA 91 8 9%
1894 ASG-24-LAL ASGLGLALLGVLALLAGDLLAGLELLGLAL 80 1 1%
1895 AGI-24-VFL AGIARDPPALEFPLDDWEIVIDVNLTGVFL 43 13 30%
1896 GSG-24-DLA GSGKSTLTRLAAGLARPAEGRVLVDGIDLA 52 20 38%
1897 ALA-25-LTG ALAMYLAAKPEKKKLVGGLLGSAALTSFLTG 99 31 31%
1898 LLI-28-LVA LLIALTIVILLSLLTLGLLIAFLIALVPLLGLVA 69 4 6%
1899 AGL-26-LAT AGLSAADVDVVEAHGTGTTLGDPIEAQALLAT 75 28 37%
1900 LAK-26-VLS LAKANERVSGDKLAGVAAISTQERVAAKEVLS 51 9 18%
1901 AIG-25-GIE AIGAAIQGGVLTGDVKDVLLLDVTPLSLGIE 42 29 69%
1902 LVG-24-VIL LVGAPPGYVGYEEGGQLTEAVRRRPYSVIL 58 18 31%
1903 ILD-28-IVV ILDEPSIGLHQRDNDRLIETLKKMRDLGNTLIVV 40 26 65%
1904 LSG-27-TLA LSGTAEVVRGNVFASRTGIEAQVIDGVFGNTLA 67 24 36%
1905 GLS-24-PLL GLSGLITPSLDEMVHVALEMERQGFDIPLL 56 22 39%
1906 LGG-24-ALA LGGALLAVGGALLSAELGVALAAELAKALA 108 9 8%
1907 SGL-26-SLA SGLEELVLDILKALIGVAAALSAGEAFGASLA 58 6 10%
1908 EIA-28-AIA EIAMKLLERVRLPEQANKYPGQLSGGQQQRVAIA 57 22 39%
1909 GVL-28-IAA GVLAGYPVVDVKAKLYDGSYHDVDSSETAFKIAA 64 24 38%
1910 ILD-27-LLF ILDEADEMLDMGFAEDIEAIISEVPERRQTLLF 40 23 57%
1911 VGL-24-ELG VGLGLSVQKLEYLPEAHTDFITYILAEELG 49 15 31%
1912 EAI-26-VLL EAIILVFLVMYLFLQNFRATLIPTIAVPVVLL 53 23 43%
1913 LGI-28-GLD LGIREEEQREKFGFLLDALKDGTPPHAGLAFGLD 51 20 39%
1914 SLG-24-LPL SLGDYLDPELISRCLAESGTVTLRKRRLPL 61 19 31%
1915 AKL-28-ALT AKLNRGRRTVEVLKQPLLKPLPVEVQVDILYALT 47 14 30%
1916 GLG-28-GAG GLGGAGGALGLLPGAGLAAGAGGVGAASGGGGAG 78 9 12%
1917 ASL-24-TLG ASLLTGRLDAAAARVSRPWTLAAWLFLTLG 55 11 20%
1918 LVD-28-ELL LVDGQGNFGSVDGDGAAAMRYTEARMSKIAHELL 61 24 39%
1919 GEI-27-LGI GEIGKNTYGVEFQDEIIIIDAGIKFPEDELLGI 49 23 47%
1920 ILA-29-ALA ILAVSLIRGGLAVVRMVALGAGAVLLARAVLLALA 96 12 13%
1921 LAA-26-VIG LAAALLAIVLLRALAIAGAVLVLAVLAGIVIG 81 2 2%
1922 LGF-28-GLD LGFTKEEAQEQFGFLLEAFDYGAPPHGGIALGLD 41 25 61%
1923 VSV-25-LSV VSVQAQVLNLLKDLQQELGLSYLFISHDLSV 43 33 77%
1924 ITA-26-IVL ITAFYTVLVEGDDMNDPIADEVRSILDGHIVL 43 32 74%
1925 LDL-24-LSA LDLGLPDGDGLEVIRDLRQWSAVPIIVLSA 54 24 44%
1926 FLA-28-LGF FLAVLLAVTALKRGQVKRIILTRPAVEAGESLGF 44 22 50%
1927 EAL-28-GSG EALLAVADKTASLIITGNGDVIQPENDLIAIGSG 61 23 38%
1928 IAL-26-GEL IALGKLAAEDPSFRVETDEETGQTIISGMGEL 51 30 59%
1930 GEL-27-SAL GELSGGQRQRVALARALAAEPPILLLDEPFSAL 54 22 41%
1931 LAT-28-IDL LATNGDTHLGGEDFDQRLIDYLVEEFKKEQGIDL 44 30 68%
1932 IVV-28-ALV IVVVENVERVMAEEGLPPKEATRKSMGQIQGALV 52 29 56%
1933 AAL-28-GIT AALAIYHTAKPENKKLVAGLLLSAALTSFLTGIT 59 31 53%
1934 VAI-27-ILD VAIARALALKPELILADEAISALDMSGQAQILD 44 20 45%
1935 RLI-24-DLV RLIGQDGEQLGVKSKREALEMAEEANLDLV 43 31 72%
1936 NLA-25-GVL NLARMRKQDIIFAILKQHAKSGEDIFGDGVL 43 16 37%
1937 LIG-24-VIL LIGAPPGYVGYEEGGQLTEAVRRKPYSVIL 54 33 61%
1938 LLT-29-LGV LLTPVVTDIKDAVNALTWDVREMEKRYLLMPALGV 64 18 28%
1939 LEL-27-LIG LELRDGDKSRGLGKGVAKALANVNGGILLALIG 50 10 20%
1940 LVG-26-TGL LVGPRPLVPDELERYGDVVALRLLVKPGLTGL 54 13 24%
1941 SGG-25-IDL SGGVMLPNHSPLKIAEQFGTLEALYPGRIDL 43 30 70%
1942 LGT-24-LLV LGTFAVLAAFGFSINTLTMFGMVLAIGLLV 56 30 54%
1943 LGL-29-IPL LGLAILTIIVWALGGINKVESEEGEGSTFIAAIPL 72 44 61%
1944 AIL-27-LGA AILVELGALLRGIMLAFSVQGALVGGIGAALGA 70 7 10%
1945 LGG-24-VVL LGGIAALWPLFGIANQMLAALALMLGTVVL 62 18 29%
1946 GLD-27-LEA GLDYPGVGPEHAYLNDIGRAEYVSITDDEALEA 52 23 44%
1947 VLA-27-IAG VLAGYPALSLKVTLLDGAAHDVDSSELAFAIAG 71 11 15%
1948 LVA-27-GLI LVAAGLHPNPVPYAHVVTTTTHKTLRGPRGGLI 65 33 51%
1949 GLA-29-ALG GLAAVAALIAALALLALAALLGAAVGLAAALAALG 110 5 5%
1951 AAL-27-LLV AALALAAVAAGGVALGAEAGLAAWAAVAGALLV 125 13 10%
1952 LGA-24-GIE LGAAGQGGGLKADVDDVLLLDVAPQSLGIE 50 14 28%
1953 ILG-26-KLA ILGAICTRRCPFCDVAHGRPLAPDKGEPQKLA 46 13 28%
1954 GSG-28-LGL GSGGVMLPNHAPLVIAEQFGTLEALYPGRIDLGL 69 24 35%
1955 DLV-28-LAA DLVGEALEGLGAQGVQLLLLGAGYRALDESALAA 72 7 10%
1956 GIV-27-GLA GIVQGGGFEDLREISAEGLRSLDFRGYDSGGLA 55 31 56%
1957 LLF-26-LLP LLFTHRGLSGIAGLQLSSLWQPGEAVSILLLP 56 11 20%
1958 IGA-28-LAI IGAGGLGDFILLGIDRNDISLILVGALSAALLAI 67 24 36%
1959 ISG-24-GGS ISGAEVGCQGEVGVACSMAAAGLAELLGGS 42 28 67%
1961 LGL-28-VLG LGLLLLSLALYILVASARLSLFLTLASLALAVLG 94 15 16%
1962 VLA-28-GID VLATNGDTHLGGEDFDQRLIDYLVDEFKKEQGID 51 29 57%
1963 AAL-24-GSG AALADAAALALDAALLLAALAGAAALGGSG 80 1 1%
1964 LAK-28-ALL LAKLLTAGGNVLLLDEPANDLDAETLRALEEALL 70 13 19%
1965 IVL-25-VGL IVLGTSSSESALPRMLAKMEELGCVKSVVGL 54 20 37%
1966 SGG-28-VLT SGGMAQRVGLARALIVLPPLLLGDEPTSALDVLT 45 13 29%
1967 ADL-25-LVL ADLMMTAPKDVEELIARLAQKARAAGIHLVL 55 17 31%
1968 ILD-27-VIL ILDEPKEGLDRSETSLLQTIGRAARNVGGTVIL 46 17 37%
1969 VLE-27-VLV VLELKAVRKGMASGGVIESPLDKGRGPVATVLV 50 21 42%
1970 AIV-29-DAL AIVDQLVTPLLSENDAQLMGLMPELLTALTGADAL 49 9 18%
1971 GGG-26-LGL GGGLSLALACLLALNTDWPGGLLGLPEVQLGL 72 17 24%
1972 ALS-25-SLA ALSPSLVLSVIVDEEAASTTVVVADYQLSLA 70 13 19%
1973 VLG-28-GEI VLGYVRALGRLSGATKVVSLHMGSAFAQLERGEI 45 9 20%
1974 LAL-24-VIE LALGGLIAAISILVRQELLLILIGGLFVIE 56 18 32%
1975 VIE-28-LAL VIELARDAGAPVILNDLAKQTPLQKMFGVNMLAL 49 17 35%
1976 LIV-24-LVG LIVAAALGAFLEGAAGFFAGLALTAALLVG 58 7 12%
1977 LAL-24-GAG LALPVLLAGIRLAAVQAIGLAALAALVGAG 90 21 23%
1978 ALE-24-AAL ALEPHIDAETMEIHHDKHHQTYVNNANAAL 100 29 29%
1979 SLA-24-LLP SLALLGLLIPLLGIGAKPAIIALFLYALLP 58 24 41%
1980 AIA-27-LSV AIARALAMRPLVMLFDEPTSALDPAFVGEVLSV 60 13 22%
1981 EIL-25-VVS EILQLLMLEPKFAILDEIDSGLDIDALKVVS 42 26 62%
1982 LLP-29-LDL LLPRKTVLENVAYAMEVIGGILAEIKDRVEEVLDL 49 11 22%
1983 DLA-25-EVL DLAALLTNLEPGDVLFIDEIHRLSPVVEEVL 53 34 64%
1984 GID-26-NLL GIDLEIKPGEVVAIIGPSGSGKSTFLRCLNLL 38 30 79%
1985 GIE-24-LNA GIEASSKKIADIISVIDGIAFQTNILALNA 39 21 54%
1986 DLL-25-PLL DLLALSLHGEPLRVGVVDLQGLPFGILLPLL 54 10 19%
1987 LGG-29-LTI LGGKAQFGGQRFGEMEVWALEAYGAAYTLQELLTI 46 19 41%
1988 AKL-24-IAA AKLLRVLQEKEIERVGSTKAIKVDVRVIAA 60 27 45%
1989 LLA-27-GLD LLAAGAAAAAGLAAFADADAADATSADVPAGLD 74 2 3%
1990 LLE-29-DLL LLEDVPGVGKTLLARALALSLDLDFKRIQFTPDLL 66 22 33%
1992 GLA-24-LIA GLALRIVNGDVPESLKDKRLLSLDMGALIA 77 39 51%
1993 VAI-29-ALL VAIARALAALPAILILDELTGALDPKTTKLILALL 69 16 23%
1994 LLL-26-IVG LLLSLGVALAGLFLLVLLKLPELLILLGSIVG 71 3 4%
1995 VAL-26-IAL VALEGALGLLELAYLLAEGTAADELAHGAIAL 75 10 13%
1996 GLA-28-AGI GLAEPVGAAQAAFILDLGLFPFVERLVGAAGAGI 73 7 10%
1997 GEI-29-ALV GEISAASQEQSAGIEQVNLAVTQMDEATQQNAALV 52 34 65%
1998 VSV-25-LGV VSVQAKILNLLLDLQAELGLTYLFISHDLGV 50 16 32%
1999 LVL-27-LLL LVLLTLSGVLLALVVIALLIALGLLLAVTGLLL 124 7 6%
2000 AIA-24-AEI AIARALILLPRLLLADEPTSALDVSTQAEI 54 21 39%
2001 SVL-25-LAI SVLTNKYAEGYPGKRYYGGCECVDGVETLAI 54 20 37%
2002 ISG-25-SAL ISGGQRQRVAIARALAKNPKILLLDEPTSAL 47 22 47%
2003 VLE-27-LLD VLEQLGFQVVVAEDGDSALEELDEPEPDLVLLD 56 25 45%
2004 GKL-24-FLG GKLSLNDASLFYEPESSAALGFGFRCGFLG 37 23 62%
2005 ALS-27-ALG ALSLLSAAYASQLLRGAIKAVPKGQWEAASALG 84 29 35%
2006 VVL-26-LVL VVLLDVFLPLLAGVGATLGILALFLVPFVLVL 70 5 7%
2007 LVV-27-ALG LVVLGLRVVGVLILQSTLLLGAAAAILVLIALG 78 10 13%
2008 VLD-28-VLV VLDEPTAGLDPKGRKELMTLAKELHQTGGTIVLV 51 10 20%
2009 LAT-27-LVA LATPVQFHIGRPFYVAAFKALRDGSGNMDVLVA 66 16 24%
2010 DIL-27-VLI DILDEVIREHPVLLNRAPTLHRLGIQAFEPVLI 42 26 62%
2011 IAD-26-LLR IADHAVATNAGQIKTGSPSRSDRGAKYNQLLR 94 51 54%
2012 LAL-24-VLS LALAAAIEAALAGGLGRGFLVLALVVAVLS 88 10 11%
2013 LIG-28-NAL LIGGMVLHEGKIAEMRTGEGKTLVATLPVYLNAL 48 30 63%
2014 LAE-25-VIG LAEAKVPYDIVLEMDEINDDFADTDVVLVIG 57 33 58%
2015 ELV-26-LIE ELVARALHRHSPRAKAPFIALNMAAIPEDLIE 47 24 51%
2016 GLD-26-ALE GLDYPGVGPEHAYLNDIGRAEYVSITDDEALE 53 29 55%
2017 VDL-24-LSG VDLPGPYGGTVILLGTALDGKIALLYILSG 50 7 14%
2018 ILL-28-LGL ILLLILFCGLLVLLLGLAADLLGPLLLALSLLGL 83 15 18%
2019 ILL-28-LGS ILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGS 52 27 52%
2020 IAD-27-GFL IADRPGLAPGLIGGMLAVSTGAGFIGGIIAGFL 39 26 67%
2021 IGA-27-AGL IGALLGAAASISGASVLCQGEIGVACSDAAAGL 69 11 16%
2022 LSG-27-GIG LSGLGSPTVGELLSAGKELLLLLGLDALILGIG 58 8 14%
2023 VIG-27-GVV VIGFKLTGALPEGATATDLVLTVTQMLRKKGVV 49 19 39%
2024 AIV-29-IGL AIVAEEGPLATLPESMLLPDAAGGTVGIFSTSIGL 55 8 15%
2025 LLA-26-SAL LLAVAIALGAALPPLATPNGRAALLFLLLSAL 107 11 10%
2026 EAI-24-LGL EAIVKGKNIPKPGVPESFNVLVKELQSLGL 66 23 35%
2027 LVD-28-LGV LVDPLDGTKEFPKRNGEFTVNIAAIEDGKPVLGV 48 12 25%
2028 ASL-27-LLA ASLLAALLAGALLASLSLGLALAAGAAAALLLA 102 4 4%
2029 ALK-28-LDA ALKALKASGGAVGILDIDGVLAATGEQAQVRLDA 52 13 25%
2030 LVE-28-AGL LVEDGEAILRYGRLLLKMDAFGATSRGQAHRAGL 61 13 21%
2031 LVD-26-GLS LVDAQQARRILDRLVGYNISPILWKKVKKGLS 47 31 66%
2032 IEL-26-ALE IELAAPVSHIWYFKGIPSRMGLLLDMSPRALE 46 24 52%
2033 LLG-27-LIA LLGLLLGLLEGAGLWLSVLTLLKNVGVLDILIA 85 12 14%
2034 LVA-29-LLI LVALTTGSGVSIIFISGIISLGLNFHPSVVALLLI 71 10 14%
2036 ILG-29-GLL ILGLSGGVDSSVVAALLHRAIGKILTCVFVDNGLL 68 22 32%
2037 GVG-29-GAS GVGMLLVERLSDARRNGHRVLAVVRGSAVNQDGAS 51 38 75%
2038 AIV-25-AIG AIVGDDYRVLNEDGLRFEDEFVRHKILDAIG 51 20 39%
2039 AIE-26-LAL AIERAKKLFGATLANVQPHSGSQANGAVYLAL 55 15 27%
2040 EGL-24-ALI EGLAQRIVNGDVPESLKDKRLLSLDMGALI 54 31 57%
2041 VGI-29-LIG VGIIILGDGTSIREGDLVRRTGKIAVVPVGESLIG 52 13 25%
2042 GGG-24-RIL GGGVIGLELASAFAKLGVEVTVIEAADRIL 42 26 62%
2043 LGT-27-GVS LGTRYSEAMGATVLDENGRSVPLIMGCYGIGVS 42 28 67%
2044 VLL-26-VLT VLLVLDATGGQNGAILARLFAELVDITGIVLT 60 12 20%
2045 IVG-26-GIA IVGAIGYRDAKEILLKGLEKLEYRGYDSAGIA 52 24 46%
2046 DLV-24-LEL DLVLFTGGIETGVAGPKAALTAVEPALLEL 50 4 8%
2047 ALA-28-LAS ALAALALLVAALGALKLLAASLALIAAAVRLLAS 109 11 10%
2048 LEL-28-LLD LELGQEGHAVDVAGNGGSGLVLAAREGEDLILLD 60 33 55%
2049 ELG-26-LGV ELGSFSAAAELLPASDLEVSKAIAALEKALGV 53 14 26%
2050 IVG-26-GKL IVGDLAGGFIFGWVVAAYLLAGFAPVPIPGKL 42 28 67%
2051 ELL-27-GDL ELLWFLKGDTNIAYLKENGVTIWDEWADENGDL 50 25 50%
2052 VLE-28-AGI VLESNGSSSQASICASTLALMAAGVPIKAPVAGI 47 22 47%
2053 GIA-29-LLK GIARALALNPELIIADEPVSALDVSIQAQVLNLLK 53 33 62%
2054 IAS-29-ELA IASIAGLEGNPAASIYSASKAGVIGLTKALALELA 52 24 46%
2055 VAI-24-IGG VAILGGAKVSDKIGVIENLLEKADKLLIGG 46 27 59%
2056 LVV-29-ALA LVVDDDLALRLLLAALLEAEGYEVATAADGDAALA 103 31 30%
2057 LGV-28-LLT LGVQRFRYGRAEGENRIGQVTGLAWTEVGGDLLT 67 26 39%
2058 EVL-29-LLG EVLALLGRMGVAPPGAKLFSLGMGQRLGIAAALLG 58 14 24%
2059 ELV-25-ALA ELVGLSDRADRYPSELSGGQQQRVAIARALA 78 44 56%
2060 GIV-26-AGL GIVYALSRRFVEEILQELLGQLEGAGPLHAGL 62 19 31%
2061 TGL-27-LVD TGLAQPAPVAQTFGNSDVFAEEKDLDGASALVD 44 20 45%
2062 LAL-26-LLT LALGLDLLPAALLHLALALLLQAGGAAVPLLT 93 11 12%
2063 LAL-27-GVS LALGTVVARVLLAPLALSFLRLAAATALVVGVS 70 12 17%
2064 ATL-26-IGA ATLAVLIGAGGLGSFILLGIDRNNAELILIGA 52 12 23%
2065 GVG-26-GKL GVGGIEAEAAMLGQPVSMLIPEVVGFKLTGKL 45 22 49%
2066 SLA-28-VAL SLALDIALGEGGYPAGRIGEGGGPESSGKTTVAL 78 14 18%
2067 VLD-25-SLA VLDALEQALWARRPSGTVHHSDKGSQYVSLA 54 36 67%
2068 LNA-26-GAS LNAGLIGEDEAKKRRKEVAQEADFYGSMDGAS 41 29 71%
2069 VLV-25-IVA VLVVAADDGVMPQTIEAIAHAKAAGVPIIVA 52 18 35%
2070 LVS-24-LVS LVSGAVHTTANTIRPALQLIKTAPGSSLVS 57 18 32%
2071 VLT-29-IAT VLTGGVDANALHRPKRFFGAARNVEEGGSLTIIAT 41 31 76%
2072 GKL-29-LSA GKLVRVVVGEVFDVAVDIRKDSPTFGKWVGVLLSA 45 21 47%
2073 AIV-28-LLL AIVSILLAEDLLLFYLNLLNLSLALLGLGLVLLL 72 8 11%
2074 AIA-24-AAI AIARVLLKDAPILILDEATSALDSEVEAAI 79 21 27%
2075 GGG-29-VLG GGGIAYNREELLEIGERGLDASPTTEVLIEESVLG 61 21 34%
2076 AIG-26-LFG AIGITFSSFLALGVILIIGANSSTDLFHILFG 56 17 30%
2077 ILV-25-GLS ILVSTTVIEVGVDVPNANTMIIEDADRFGLS 49 35 71%
2078 ALS-28-ADL ALSQLNRSLEQRADKRPVNSDLRESGSIEQDADL 61 26 43%
2079 ALL-25-ILL ALLGAGLLIIILLILLLLLAVPLVLAARILL 93 6 6%
2080 EAL-29-EAL EALAAAREIQDETGRADALLELAEKLPPVLLSEAL 97 24 25%
2081 GAI-28-VAI GAIGLKLVEDGYVPPAAIIKALGLADLAGPQVAI 50 11 22%
2082 GLF-24-GVV GLFCEAIFGPSKDWECLCGKYKRVRYKGVV 42 15 36%
2083 LVS-29-LLP LVSLFGPGYSIGGLMLGEYSQAMNHVAGFTTSLLP 53 8 15%
2084 EAL-25-GAL EALNAAGVELVAFLVVLNDLEMLIAAAVGAL 70 8 11%
2085 VLA-26-VGK VLAGLTAREAKVLRMRFGIDMNTDHTLEEVGK 43 16 37%
2086 IEA-26-LVA IEAARNAIIDEAVGTLLEQGLGVDLRHEALVA 51 12 24%
2087 LLL-29-LIG LLLGVILGGILFAAGVLGAGLLLLGSLAIALGLIG 94 7 7%
2089 AIA-27-AIG AIARNLREMARLKVPVICTVIGEGGSGGALAIG 63 24 38%
2090 LAE-26-GLF LAEYGRKSWLAEVIRFIIDILLSAPSIVVGLF 43 21 49%
2091 VLE-29-GIA VLESNGSSSQASICAGTLALMDAGVPIKAPVAGIA 48 22 46%
2092 TLG-29-LFG TLGLAFLLAIMETVYVMTGKQIYKDMTKFWGKLFG 43 23 53%
2093 LNA-24-TGL LNALLEGYPPIADVPRAGIVHRLDKDTTGL 41 15 37%
2094 LLL-29-GVS LLLILDDLLVLAATFLGPALSRSALDRCLRRHGVS 68 12 18%
2095 LLE-26-EAL LLEILEALSEEARAMGASPLQIVLKVLLPEAL 89 13 15%
2096 ALE-28-LLG ALESADLDKLYLLGIAVLLAVASIEAGELLGLLG 65 5 8%
2097 VLG-24-VGL VLGTSSSESALPRLMEKMEKAGCKKSVVGL 66 30 45%
2098 GGG-29-LAE GGGAFSGLAGSKVLLSAAYAIRYPLGNGAGIYLAE 66 26 39%
2099 IGL-26-VAI IGLKLGEDLGISPAAIKPVLGGAIIADIQVAI 50 11 22%
2100 DIL-24-VLD DILIATPGRLIDYAKQGHINLGAIQVVVLD 41 22 54%
2101 LDG-27-LGA LDGGRFATSDLNDLYRRVINRNNRLKRLLDLGA 58 22 38%
2102 LAA-24-DLL LAAGNCVVLKPAEQTPASILVLLELIGDLL 96 28 29%
2103 GAG-27-ATL GAGKSALALAITLAKQARAVVLGAFAAVAIATL 59 13 22%
2104 GIV-28-LPL GIVFIDEIDKICKRGESSGPDVSREGVQRDLLPL 46 28 61%
2105 LIA-29-LVV LIARWKAFLGSAIALTLAFALYLVGKEIIATALVV 60 15 25%
2106 IAL-26-ATL IALGVAGLIVTQGTDLSLGRAVGLTALLIATL 59 12 20%
2107 GIA-27-GLS GIAAEKLKRIFEAFFQADGTTTRRYGGTGLGLS 54 22 41%
2108 TLA-29-LGF TLAALREEKLTALGGVLHCLTGDLLRAGLLLDLGF 49 14 29%
2109 LEA-26-LAA LEAVVRYLAAALGPEGIRVNAISAGPIKTLAA 99 20 20%
2110 GSI-26-GFL GSIRIHDTELQEKVFEVLGITEEEAQEKFGFL 37 29 78%
2112 VLA-25-GSL VLALLPDAPAGAAGISLFLVPKFLVNADGSL 61 14 23%
2113 AGL-25-VVS AGLQGAGKTTSVGKLAKFLKEKHKKKVLVVS 58 22 38%
2114 VVL-26-GLL VVLLGTFAVLAAFGFSINTLTMFAMVLAIGLL 74 32 43%
2115 LLL-24-IPL LLLTRLLKVRAGRGDGLSVLLVLELLLIPL 66 7 11%
2116 VLL-27-VVI VLLLVDAFDGPMPQTRFVTKKAFALGLKPIVVI 55 26 47%
2117 ALA-24-GAS ALAVAGLGAQALARNPLADPGIIGILSGAS 86 22 26%
2118 SLA-29-GAI SLATIGVLITILLTGGMALWLFPLDGLEGLLAGAI 55 24 44%
2119 LVV-24-VLL LVVLVIDIFDFNGSLIPGLLLLVGGNDVLL 71 10 14%
2120 ELG-27-LLD ELGQPMHAFDKDRITGGIVVRMAKAGEALVLLD 57 15 26%
2122 DLI-28-GAI DLIEANEAFAAQALAVGKELGFDEEKVNVNGGAI 41 30 73%
2123 GVG-29-LLT GVGADFDIEDINYDKIIIMTDADTDGAHIQVLLLT 50 25 50%
2124 RLI-25-GIT RLIQDCGGLSDREMSAQVLDSMDLERERGIT 36 21 58%
2125 DAL-28-LGL DALGKLQLNDAALFYEPETSSALGFGFRCGFLGL 75 31 41%
2126 AIS-26-LGV AISLLVVFLCLAALYESWSIPFSVMLVVPLGV 47 20 43%
2127 ELL-26-KLA ELLDRVQLEITEIGEALNAPISTLPLAVEKLA 54 11 20%
2129 AAL-25-GEL AALDLAYLAASRVAGLFEIGLAPWDTAAGEL 92 10 11%
2130 GLV-26-VAI GLVIRDFAVAAANGRMIETLSSAVLEHNIVAI 53 14 26%
2131 LEA-26-ADL LEAAAQALLSHLRLVVLIARELAGYGGPQADL 62 9 15%
2132 AAI-25-SVV AAITITVLTLAAVHTLGIPVDLPTALLLSVV 50 19 38%
2133 VSL-25-LGI VSLTGVALGGLASVLPLGIGAGLLFAKPLGI 58 8 14%
2134 SGG-29-IAT SGGQQQRLCIARAIAVEPEVLLMDEPTSALDPIAT 42 28 67%
2135 ILD-27-AIL ILDADKEGFLRSERSLIQTIGRAARNVNGKAIL 46 24 52%
2136 IAL-29-LGL IALGLAFAAYAAEIIRGGIQAVPKGQKEAARALGL 92 32 35%
2137 GIA-25-NLA GIAESFVKTIKRDYISIMPKPDGLTAAKNLA 44 25 57%
2138 LPL-25-VLI LPLLAFFGVAADDVIGTLAREAIKAGRPVLI 53 10 19%
2139 VIE-25-IVV VIEAELDKGKGPVATLLVQQGTLNVGDPIVV 40 20 50%
2140 VIA-25-RIL VIALFDAVLAMLKANQFTIAQSQGGDAPRIL 42 6 14%
2141 GLS-26-GVG GLSGRPLQLRSTEVLRRLRGELGGRIPIIGVG 52 31 60%
2142 LSG-29-IEL LSGGMKRRLMIARALMHEPKLLILDEPTAGVDIEL 45 20 44%
2143 LLT-29-ALA LLTLVGLLAAALLLIAAALALTAAQLLRALAVALA 100 4 4%
2144 LVG-28-GAS LVGALLALAGLALQGLATNPLADPGAVGLLSGAS 50 17 34%
2145 LLE-28-LLE LLEHENSDVRYRAASALGEIKSEAAIPGLINLLE 81 20 25%
2146 LVL-25-LGL LVLAATFLALGLLGILLQRISLGALLIALGL 105 17 16%
2147 GIE-27-GVS GIEEHNNYAVDFIEATRDIKRELPHALISGGVS 38 23 61%
2148 LAL-24-LLK LALEPILLVCDEPLSALDVSVQAQILNLLK 76 17 22%
2149 LLV-24-LGL LLVATTVIEVGVDVPNASLMIIENPERLGL 114 21 18%
2150 LLT-27-DAL LLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDAL 57 29 51%
2151 GLG-26-GSG GLGQNVARQLALKAGLPAEVPAFTINKVCGSG 55 21 38%
2152 DAL-29-VIA DALKYGTPPHAGLAFGLDRLVMLLTGADNIRDVIA 54 26 48%
2153 GIA-25-ALI GIAGMISMKAVGMMGRSAALYFLIVSTIALI 60 13 22%
2154 TLA-29-LAL TLAGLVLALALVWLGSLALAGLLGLALARELALAL 98 8 8%
2155 VIL-26-LLV VILGGGNLLGLAGGLISLLSSFGGPAALLLLV 55 6 11%
2156 IGA-24-LLL IGAPPGYVGFDQGGLLTDAVIKHPHAVLLL 74 23 31%
2157 SGV-29-GDL SGVRPELLELLLALLNADVSPVIPEQGSVGASGDL 40 22 55%
2158 GDL-25-LVE GDLLVFNNTRVIPARIFGRKASGGKLEVLVE 43 18 42%
2159 VLV-25-IAS VLVGGAGSISLAGLRRPIVVRIPAVGALIAS 48 6 13%
2160 LVA-24-LLE LVADDAVEIRQKDEDTLAGKCPEILEHLLE 66 21 32%
2161 LLV-28-EAL LLVDDDPANREALERLLESLGYTVVVAASGEEAL 71 34 48%
2162 RLI-25-VIL RLIGAPPGYVGYEEGGQLTEAVRRRPYSVIL 39 28 72%
2163 LDG-25-LEL LDGGRFATSDLNDLYRRVINRNNRLARLLEL 44 20 45%
2164 VLS-29-IAG VLSIDLLASAPMAAMFASSLALSLSDIPFIGPIAG 51 14 27%
2165 GAL-26-ILG GALDLREWCAVHPGEPFPVSVALGADPATILG 59 18 31%
2166 TLA-28-IGG TLAIAGVLGYTTAGLALALLLLEARRIAGALIGG 52 11 21%
2167 TGL-29-ALI TGLTAVVVGLLFLLAIFFSPLAGMVPAYATAGALI 52 27 52%
2168 ELA-29-GVL ELALHSKAEIDAGFAAVWQVMAAGIERGMNTEGVL 58 19 33%
2169 VLV-26-LTG VLVNNAGITLDTLLLEMTEEDWEAVLDVNLTG 55 16 29%
2170 IGA-24-GIE IGAAIQGGVLTGDVKDVLLLDVTPLSLGIE 40 29 73%
2171 LAL-25-GGI LALRLAEGLLVGVLSKGLLGGGIPGVAQGGI 65 11 17%
2172 LSL-24-LAI LSLVGLSALLLAVFVPGLAILLGVFSALAI 71 7 10%
2173 EAL-29-EIA EALTAIDINSARATKGGDIEETALNTNLEAADEIA 62 28 45%
2174 GLS-27-ELG GLSLIFIAHDLADVKHISDRVLVMRLGLAVELG 48 13 27%
2175 ELG-28-VLF ELGVNLRVTSGPVIEKAGDLAALLTNLEPGDVLF 36 25 69%
2176 LEA-24-NLA LEAGSQSFRIAKSILNKGVQVIVLNPGNLA 46 15 33%
2177 ITA-24-VLD ITATQMMESMITNPMPTRAEVMDVANAVLD 39 27 69%
2178 LSG-24-VSL LSGGSAPLEGMPALLQAGLLTAPATHFVSL 53 8 15%
2179 ALK-24-LLK ALKDLSLVLKGAEILGIIGPNGAGKSTLLK 59 11 19%
2180 SGL-25-LDA SGLLLGPAGGRLALRTSSAGTGALIGYALDA 52 13 25%
2181 NLL-27-LAA NLLALNAAIEAARAGESGRGFAVVADEVRALAA 59 29 49%
2182 GVV-27-TLI GVVTRPFTFEGRRRMRQAEQGIAALKEAVDTLI 40 32 80%
2183 ALS-24-GAG ALSTRNDDPQAASRPWDKDRDGFVLGEGAG 68 34 50%
2184 LLA-27-IGA LLAEAKVPYDIVLEMDEINDDFADTDVVLVIGA 80 32 40%
2185 LVV-29-VLT LVVNNIRGILKAAAVKAPGFGDRRKAMLEDIAVLT 51 19 37%
2186 LVD-25-LVE LVDDLLGVLALAGLALEVDVDDLSDVDVLVE 51 6 12%
2187 TGL-25-AVL TGLTLLDTIQNAVGAVSLRADALTPHEEAVL 64 13 20%
2188 LLV-26-GSL LLVVNDDEIVKAHVHAEGPGLVMVGGLKYGSL 58 14 24%
2189 IGL-29-SIA IGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIA 46 36 78%
2190 GVG-25-VLS GVGKTAIVAGLAQRIGNNEVPEGLNVKRVLS 45 11 24%
2191 VAL-29-LGL VALALGLAATPVPLLRVALLPAGGGLLEAALALGL 97 7 7%
2193 IVV-28-VSG IVVDDTAITPTIGAIALDELIKAGEAGKFVAVSG 40 6 15%
2194 GID-27-SGL GIDDMVIPLKKEEIISEAEAEVAEIQEQFQSGL 44 19 43%
2195 SVV-28-IGV SVVSCDTDFGTCARCYGRDLARTDQVNKGEAIGV 38 10 26%
2196 AAI-27-VLG AAIALAAHPEYLGALDIQLGKKESGEATGKVLG 66 9 14%
2197 IEA-26-GAI IEANEAFAAQALAVGKALEFDEAKVNVNGGAI 42 22 52%
2198 DVL-24-AVL DVLYTGRTIRAAIDALVDLGRPARIQLAVL 57 28 49%
2199 DAL-25-AAL DALEPHIDAATMEIHHDKHHATYVNNANAAL 116 26 22%
2200 GLG-26-VLG GLGGERLLAILEVGGITGGIEAIGAGLLAVLG 72 7 10%
2201 IGG-25-VVL IGGNIATNAGGLRVLKYGVTRELVLGLEVVL 51 28 55%
2202 GLF-24-GVI GLFCARIFGPVKDYECLCGKYKRLKHRGVI 42 25 60%
2203 ELA-29-RLI ELAKALAESLFDSEDAMIRIDMSEYMEKHAVSRLI 49 24 49%
2204 GGI-24-VLF GGIDGLEPGFETKMAEQSLLAIEEADVVLF 39 16 41%
2205 VLL-27-LLG VLLVLLVLALGATAGVRLDKLALAVLALAALLG 102 2 2%
2206 LLF-29-AIT LLFGEPGEVVLLITNPRDFPGLVRELDEVHFFAIT 38 19 50%
2207 LVL-26-IAS LVLVLTNLTISLLRAWLPLEIRILIYVMIIAS 52 10 19%
2208 LLI-28-AVL LLIVSQPTRGLDVGAIEYIHKRLIALRDLGKAVL 69 19 28%
2209 AAL-26-LLS AALGVVLAAALGLTVVGLLLAALAGALLVLLS 104 8 8%
2210 AAL-27-LEL AALAYGLDKTDKDEKILVFDLGGGTFDVSILEL 77 25 32%
2211 LAA-27-GIA LAAALAGLPAFVVAEAVEDLLLMGALGAGAGIA 89 6 7%
2212 AKL-26-LEA AKLEEYMGNLIRAAVELAKDWRTDVNLRRLEA 47 14 30%
2213 IGS-24-LLL IGSAIALVLLEAGPLLVGAFITALDVFLLL 55 8 15%
2214 AVL-27-ALT AVLLAAAIAAFGGSLAAAVLARLAGALAALALT 77 6 8%
2216 GEL-24-LDV GELQRVAIAAALKREADLYVLDEPSAYLDV 44 19 43%
2217 AIA-25-IGS AIAEGLAWRIVQGDVPLVILDCTISSLDIGS 49 11 22%
2218 VLI-29-EAL VLIVDDEERGRLLLAFGLEAEGYEVAEASGGKEAL 57 15 26%
2219 AIG-28-GGI AIGAGLPVHEPTGSMVVDIGGGTTEVAVISLGGI 53 29 55%
2220 ALI-29-VLL ALIVSPGRGGLTLLLQLIAAAITANGLEVAGIVLL 80 11 14%
2221 SLG-27-LGG SLGHLVGDLLLKEVAARLRAPLRALDTLARLGG 61 25 41%
2222 NAL-29-LLK NALRRERIPVSIYLVNGIKKQGQIESFDQFVILLK 45 13 29%
2223 VLV-25-LVA VLVSGTDGVGTKLRLAIDLKKHDTIGIDLVA 75 30 40%
2224 VGL-24-GSI VGLAAPVIEELLVGGQSEAALLICIVIGSI 42 6 14%
2225 GEI-29-LID GEIFVIMGLSGSGKSTLVRLINRLIEPTRGQVLID 40 15 38%
2226 LPL-26-GAG LPLALPVIMAGIRTAMVLAVGMATLAALIGAG 55 29 53%
2227 GAI-25-ALT GAIVGTNGGELLGEIGLAIEMGCDAEDIALT 49 13 27%
2228 LAL-25-NAL LALLAINPLVATARGDLAKLDAKLAADLNAL 66 10 15%
2229 AGL-28-IVG AGLPNAFGEYDLDADTMAKIIASPARAGFINIVG 62 15 24%
2230 VAL-27-GLV VALAGAVGRGAALKKILGILVGEALLAAASGLV 75 8 11%
2232 IEA-28-SGG IEAAKLAGAHEFIMELPDGYDTIVGERGVNLSGG 42 35 83%
2233 LSV-27-LAL LSVTGLFAVAGASVDTAETGGARALRALAALAL 71 3 4%
2234 GSI-29-VID GSINLAKSGLTGNGDTNKLIETGMLAVGDLDNVID 37 18 49%
2235 ALS-29-AAL ALSGLDSLLSIVQMPAGIPVATLAIGAAGAANAAL 121 21 17%
2236 AAL-24-ELL AALSALEAEIGAGTDPVRRQAREVGAVELL 97 14 14%
2237 EVL-24-AIA EVLDLVGLEGKARRFPDQLSGGEQQRVAIA 57 22 39%
2238 GIV-27-SGG GIVSALGRSGLNAENYENFIQTDAAINPGNSGG 46 33 72%
2239 DAI-28-LGG DAIKPGQRVLIVDDLLATGGTIEATIKLIEKLGG 43 35 81%
2240 ALG-27-GLS ALGILFPAAANTAHGIGLIDEGLVLMLRSYGLS 71 8 11%
2242 GAG-25-ALS GAGGAAHLPGMIAAKTTLPVLGVPVQSRALS 65 26 40%
2243 AVL-25-AIV AVLALFGFSANTLTLFGMVLAIGLLVDDAIV 63 13 21%
2244 LLP-27-VLA LLPADVTGLSAYRQLTGEFEFVLGPIFANLVLA 73 20 27%
2245 AEI-29-VIL AEIVRGGVESVPKGQREAARSLGLSRGETMRYVIL 38 25 66%
2246 IVV-29-TGL IVVGNTFGRVRAMTNDIGRRVKFAGPSTPVEITGL 42 17 40%
2247 EVL-26-DVL EVLDTCNVIAAAPDGAIAAYVISMAATPSDVL 48 15 31%
2248 SVV-28-LLG SVVISLLAPGAAAVVIGVADALLVITIMIGALLG 54 8 15%
2250 LVL-29-AIA LVLDEATPALDEEAEAAIQELLRELLGGKTVIAIA 84 15 18%
2251 DLV-26-ILA DLVIEAAGETLPIKQAVFRELEAEVKAEAILA 48 16 33%
2252 SLL-29-LAL SLLLSADALSLATRLLIEALSALALALLLALALAL 104 8 8%
2253 LVA-27-RLI LVAGTTGSGKSVAINTMILSLLYRLTPEECRLI 49 18 37%
2254 LEL-27-LVG LELVFGIKASGITMIFSRHREFVADGGAAALVG 51 11 22%
2255 DLA-24-LTL DLAKLALAVNLGDLAAEGAPALSLILALTL 52 8 15%
2256 GIS-24-VVL GISALRDESDKDGMRIVIEVKRDAVGEVVL 46 31 67%
2258 LLD-25-LVV LLDETDNILDGEIVPPLQVVLHDEDDPYLVV 55 16 29%
2259 LGI-24-GLS LGIDNLVFIAILAGKLPPKVRDLARLIGLS 57 12 21%
2260 ALG-25-LDL ALGFGFRCGFLGLLHMEIIQERLEREFDLDL 66 32 48%
2261 ALG-28-AGI ALGGTIGVGLGSGAASTIGLLGASVLLGALVAGI 74 21 28%
2262 LGV-26-LVE LGVIKEMPVKTIVRGKSNLKGFKELSNVPLVE 54 16 30%
2263 IGL-29-VIA IGLDDAEIAKACREAAQGQVSSPPNFLSPGQVVIA 59 13 22%
2264 LVA-29-LAI LVAALFVILFAGAGLLFLLLLDIAIRSALLGELAI 65 10 15%
2265 LIV-26-LLP LIVTAAFGQILPEKLLAAPKKGIINVHASLLP 48 17 35%
2266 GIV-27-LVA GIVVNDGMQTSDPDIYAIGECAEHNGKVYGLVA 54 21 39%
2267 GGI-26-LGA GGIGSALAVLAALALGAAGGLIGALLLYGLGA 59 9 15%
2269 DVI-29-LVE DVIESAASKTGKAHVIKSHHNVGGLPEEMKMGLVE 42 24 57%
2270 ASL-29-LLG ASLETNSFLSAASFQETTRVLTDAAIKGKKDELLG 79 24 30%
2271 GIG-26-LAA GIGRAAARRLAFAGGKVGLVARLVAALELLAA 82 10 12%
2272 LPL-29-GGS LPLALAFAIASGVGPEKGLITAILAGFLASLLGGS 42 17 40%
2273 VIE-29-ALV VIELKRDAVPEVVLNNLYKHTALQSTFGINMLALV 46 27 59%
2274 GIG-29-GLV GIGISERKRWLLFGAFSQADASRSRRYGGTGLGLV 62 24 39%
2275 LTG-25-AIL LTGGNFTITNGGVFGSLMSTPIINPPQSAIL 50 17 34%
2276 AIA-29-ALE AIARAILKDAPILLLDEATSALDAESEALVQAALE 71 26 37%
2277 LAA-25-AIL LAATLAGLANDVYFQVGLLTTIGLAAKNAIL 86 14 16%
2278 LIV-29-LGF LIVNTASKCGFTPQYEGLENLYKKYKDQGFVVLGF 42 25 60%
2279 TLA-28-TLL TLAATLAGGVSGTFAALTAGGFVAVLIVILDTLL 63 13 21%
2280 NLL-27-IAV NLLKDLQRELGLTYLFIAHDLSVVRYISDRIAV 42 20 48%
2281 GEI-29-LLI GEIQINIEESVRGDDVFIIQSTSFPVNDNLMELLI 41 25 61%
2282 NAL-28-AIE NALVKQYQKLLELDDVELEFEEEALEAIAKKAIE 39 24 62%
2283 GLF-27-GIG GLFNSGTGNVGFFNSGTGNFGIGNSGSGNTGIG 43 21 49%
2284 LLL-25-VLV LLLDGPTNLLLLLLALALTLAALGLAGGVLV 92 5 5%
2285 AAL-26-VLD AALAAALAALPATLALDRSLLAAAADRGTVLD 76 1 1%
2286 AVL-28-DLL AVLREAGAASGVEMAAAAHAAGEDAIDAHHSDLL 61 7 11%
2287 LGA-24-GLG LGATRWEVLRMVVLPGALPGILVGAALGLG 76 18 24%
2288 GID-26-VIE GIDELLEAILLVAEVLELKANPKGAASGAVIE 42 19 45%
2289 LGL-29-IGL LGLPLLLARLAALALLSGLSALLVLLAGAIGFIGL 79 19 24%
2290 GGI-27-SVL GGIAYNKEEFLEIIERGLDASPTTEVLIEESVL 43 19 44%
2291 VLF-27-IGV VLFYLFPQFLADPLLLFRVWSGGMSFHGGLIGV 38 10 26%
2292 LAS-24-DAL LASAVAERYDDGGRAKADLVLALLGVLDAL 60 8 13%
2293 KLA-29-AGL KLAEAIDSPKVRRILLAFAKTGRSLLIAATVGAGL 58 7 12%
2295 LGL-24-ALE LGLATPTAIMVGTGRGAQLGVLIKSAEALE 77 25 32%
2296 LSG-26-LGI LSGLADLLAGEIAADGLEVLLLLPLGALALGI 65 13 20%
2297 ALG-25-TLA ALGVILALDLILELRSLAAAPARVLQALTLA 77 4 5%
2298 ILL-26-GVI ILLSAVAILAALFVLTPVVVMMRVLSLLAGVI 54 14 26%
2299 AAL-25-GAS AALAVSGAVLQALLGNLLADPGILGISAGAS 88 19 22%
2300 SGG-24-VGL SGGQRRRLALARALLHDPEILILDEPTVGL 46 30 65%
2301 SLL-28-LLF SLLAAMGGLLLLKFLVLRLGLGVMILHPGKKLLF 65 11 17%
2302 LLR-27-AGL LLRMEDELHKRVIGQREAVDAVSNAIRRSRAGL 73 27 37%
2303 GEI-28-LVD GEITDHRTTFTFADGCDVSELGILTYEIHFELVD 40 6 15%
2304 IPL-27-GGG IPLKSIDDVDSIDLTVDGADEVDPDFNGIKGGG 39 21 54%
2305 AAL-28-GDL AALMTRGLAEIARLGAALGARPETFLGLSGLGDL 68 28 41%
2306 LVI-25-ILV LVIAAGFSLGSFLLGAIGLGILIAGGASILV 44 4 9%
2307 VEL-28-ALL VELSKRVGLSPTPCLERVRRLEIQGFIGGYTALL 62 14 23%
2308 GLD-28-LID GLDANFILAKDGVAIQDIALGKSIKASDVAMLID 42 14 33%
2309 SVV-26-GIL SVVANAVKAGDGNYGYNAATGEYGDMIEMGIL 43 19 44%
2310 GLS-26-LIG GLSGLITPSLDEMVHVAKEMERQGFDIPLLIG 60 22 37%
2311 LEA-24-LGI LEAFVRIAHGIIIFPGGVGTAEELLYLLGI 49 17 35%
2312 LVV-25-LLT LVVPLGVIGALLAATLRGLENDVYFQVGLLT 61 29 48%
2313 GIA-25-EVL GIARALAINPEVLLFDEPTSALDPELVGEVL 46 19 41%
2314 LGV-25-TLL LGVAGLIVTQGADLSAGRQVGLAAVVAATLL 64 10 16%
2315 LAA-26-LGV LAALVLGGLLLAALLLAADTASLLLALAALGV 107 3 3%
2316 ADL-27-ALK ADLGAEKFLDIKCPNLGLSPDAVVIVATIRALK 48 24 50%
2317 IAD-28-ILL IADEPTTALDVTTQAQILRLLRRLNQNNNTSILL 41 27 66%
2318 LAL-27-SGL LALAGYLALALGLGFAAGLGLLFADLLALLSGL 77 8 10%
2319 LIG-27-AAL LIGDSFAGLLLGAIADGTLVFGLAGLAGTFAAL 88 9 10%
2320 LGG-25-LLA LGGALIYLLREDLNHTGAHKINNALLGALLA 103 17 17%
2321 LAE-26-SGL LAEGPVLAVHQPDEGLAAMDEWNVRTHTASGL 55 20 36%
2322 LGG-24-SAL LGGAVGKSAQLPLQTWLADAMAGPTPVSAL 61 12 20%
2323 LLL-24-AIV LLLDGPTNHLDLESGEVLEDALSLFVGAIV 77 14 18%
2324 ALL-26-SLV ALLQISEPLLSAAPHQLRLAAGIDLGTTNSLV 74 16 22%
2325 AGL-28-ASG AGLALALSRGETSALVGILEGLKGAAAGLVLASG 73 8 11%
2326 IVL-28-LGF IVLYQPEIPANTGNIARTCAGTGTDLHLIKPLGF 44 17 39%
2327 GAG-26-AIG GAGAIISEALPFIVLTILAGGAALAGLLTAIG 58 8 14%
2328 ATL-25-LGA ATLAEGTTIIENAAAEPEIVAAAAFLATLGA 66 12 18%
2329 DLV-26-RIL DLVHAIPLYAIKQGLLTVEKKGKKNIFSGRIL 41 23 56%
2330 LVL-28-LVI LVLERALRIVLAKIDIIILADLITRLARAYNLVI 62 8 13%
2331 LLT-27-ELL LLTALDSIEDRVAGLDLGADDYLVKPFAIEELL 63 18 29%
2332 GLG-26-LLE GLGGSLIGTGVGTTVLEGGQRTKVDGRELLLE 57 19 33%
2333 LAI-27-LVG LAIAVGLGSLAALVLPRSGIGHKHGIVLGVLVG 67 10 15%
2334 SLG-24-IGL SLGQRMRADIAASLLHNPKVLFLDEPTIGL 54 14 26%
2335 LVV-27-ALS LVVAGAALAFQALAQILYVLAGAAALLVGLALS 58 9 16%
2336 DAL-27-LAA DALAALAALGLASAARLGLPAALGAAAAGALAA 108 13 12%
2337 VLD-25-VGL VLDMTVEEALEFFEAVPAIARKLQTLVDVGL 50 39 78%
2338 NAL-26-ALA NALVEAGELQAFPLAAFTQSDGDHIAAAAALA 72 6 8%
2339 GIE-29-ILG GIEQGALMALYFADEAIITTNPEVSSVRDSDRILG 37 18 49%
2340 AIT-25-VGL AITAGFAARRVLGGLASGAWAPQLHAFAVGL 42 9 21%
2341 LAS-29-ALA LASLAEPLLARFLLGAELLLALGTTLLALFLAALA 113 7 6%
2342 LAA-25-ADL LAALKMAKDAGYTAVISHRSGETEDALIADL 100 14 14%
2343 LSG-25-GVG LSGRPLQERSTEVIRRLRLELGGRLPIIGVG 50 31 62%
2344 ILA-28-VIL ILAVLGAEALQSAVNALPLSILLVLAAAGAIVIL 51 6 12%
2345 IGL-27-GIA IGLFGTVWGIMHAFIALGIVKQATLAMVAPGIA 57 24 42%
2347 ALT-29-GLS ALTSFLTGITEPIEFSFLFVAPILFLIAALLLGLS 56 19 34%
2348 GIA-27-IEL GIAMGVGTDVAKETADATLGLGTEATRAGIIEL 42 21 50%
2349 LAI-29-AGL LAISAFGIGTTEFISVGLLPLGSVLLIVSAALAGL 73 12 16%
2350 LAI-29-LVE LAIKQTLYRTSGDSPIVQALIDAAEAGKQVTVLVE 46 19 41%
2351 VLI-29-ELL VLILTARGSGDDRVDGLRAGADDYLVKPFAVEELL 55 19 35%
2352 VVI-29-NAL VVILLDSITRLARAYNTVVPSSGKVLTGGVDANAL 38 29 76%
2353 LAL-25-LPL LALRDEVADLEAAGIGIIQIDEPALREGLPL 93 28 30%
2354 ALS-29-ALS ALSLTQLAALSTDQLAALTATDILALLTTQVAALS 78 21 27%
2355 LAK-24-LLK LAKEGKRYSDGSANNLTHGTFEAIQYYLLK 60 15 25%
2356 LSA-24-TLL LSALEARYARAQPLRPSIDLPPRLVLLTLL 67 7 10%
2357 LGA-27-LIG LGAALLGVAALGGVALAIVLGVGILALIGLLIG 68 1 1%
2358 GLV-28-LGA GLVYILLPFLVLPLYSAILGLDSALLEAAPDLGA 79 15 19%
2359 LIE-29-RLL LIEATSDCGAYVMVHGALKRLAVKLSKICNDLRLL 52 24 46%
2360 VLE-28-NVL VLERRQRDAENLSQGNVLERRQRDVENQSQGNVL 37 15 41%
2361 LGL-25-GIG LGLTQPGITILCGDSLTSTHGAFGALAFGIG 67 12 18%
2362 LLT-27-ALI LLTGSVKGAKRRELLAKLETGEIDILIGTHALI 63 24 38%
2363 LSA-24-AIA LSAAAALILLALLSKALLLAGGLAELDAIA 73 6 8%
2364 LVE-25-AAL LVEAARIAGLSPGRFFRGILLPLSGTNLAAL 78 11 14%
2365 ITA-27-VLS ITAFYTVLVEGDDQQDPIADEARAILDGHIVLS 39 33 85%
2366 LEA-25-LAT LEAGSQSFRIAKSILNKGVQVIVLNPGNLAT 52 17 33%
2367 TGL-24-LLD TGLSGSGKSTIAGALEEALHALGVHTYLLD 52 23 44%
2368 LLA-24-GVV LLAGIAAGPTGLGLIFLIAHFLLFAELGVV 89 12 13%
2369 AIA-25-LGL AIAADPELALDITTKGNTVAVISDGTAVLGL 97 23 24%
2370 EIA-28-GAS EIAQRLGFRLPNAAEEHLKALARIGVIEAVPGAS 42 14 33%
2371 GVG-28-GIA GVGQIHPIFAARAENTAVWDVEGDEYIDFAAGIA 55 18 33%
2372 LLA-29-ADL LLAVLHRHGGLQMADQDVFVNVVGGVKVTETAADL 85 26 31%
2373 VLV-25-LLL VLVGLLMLLYVLLGAALLTVWVGIILAVLLL 86 9 10%
2374 AIV-27-AGL AIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGL 71 34 48%
2375 SLL-24-EIA SLLEEFLIAAVAGKLTLSLSGGERRRFEIA 54 9 17%
2376 LLK-27-LGV LLKTGAYGLLRFNLALLPNAHAYFAPVAMILGV 53 16 30%
2377 GVL-25-VIV GVLEPLQAAPTIIEDNCFIGARSEIVEGVIV 52 17 33%
2378 GVG-24-LTG GVGGIEAEAAMLGQPVSMLIPEVVGFKLTG 49 36 73%
2379 GLD-26-AGL GLDLLDLLGEAPTLVGGEGAGIRTALAIGAGL 58 13 22%
2380 FGL-26-ALT FGLPAAALAMYHTAKPENKKVVAGLMGSAALT 44 29 66%
2381 YLL-26-LEV YLLHQFLSPSSNHRTDAYGGSLENRARLPLEV 35 25 71%
2382 VAL-25-VLL VALALAFGAGLLLLLAGLSTALGADLALVLL 90 10 11%
2383 RIL-28-SLG RILEYLAVQSRVNKLKGPILCLVGPPGVGKTSLG 41 27 66%
2384 VLD-25-GAS VLDSRGNPTVEVEVYTESGAFGRAMVPSGAS 44 34 77%
2385 LAL-29-ILA LALLGGAIALALAALITLLLVLALLALALASAILA 85 10 12%
2386 LIA-29-LLI LIAAATGSGASLCINSLIASLLYKAIPILVLLLLI 69 11 16%
2387 ALS-29-GLS ALSLLFLAYLSATLRAALSAVPAGQLESGQALGLS 63 16 25%
2388 GLA-25-ALV GLALLGLALAATALADAGGAAVRGLIVLALV 94 2 2%
2389 AGL-29-IGG AGLAGLVLAARLGAAEAAAGVGEELDAIAAVVIGG 74 25 34%
2390 GGG-28-SIA GGGICHNEEELREIVTNGLKLSPVTQCLIEKSIA 43 26 60%
2391 ASG-28-IAA ASGTEIIDELGEEHMKTGALIVYTSADSVLQIAA 57 17 30%
2392 EVL-26-GAS EVLDSRGNPTVEVEVYTESGAFGRALVPSGAS 42 32 76%
2393 GLV-24-VLA GLVAAFLGGLLAALLALSPLVGISAAAVLA 76 13 17%
2394 ILG-29-ALS ILGGVLAHLILGLVGSAALIVAIMAAFLAIAEALS 55 6 11%
2395 ADL-27-TLG ADLAEGMKVKCTGRILEVPVGRGLLGRVVNTLG 48 13 27%
2396 AIS-28-SGV AISYRVHQGFDHRGVALSAGVQRMVRSDLASSGV 38 23 61%
2397 LAA-27-ALT LAATLSAVPALPVAGLALILGIDRFMSEARALT 106 23 22%
2398 ILG-24-YGL ILGKEPVKNGVLDIFQASKEIKALSERYGL 38 14 37%
2399 GGG-24-IVL GGGTALVNVIEKVAALELEGDEETGANIVL 52 18 35%
2400 DLA-25-EIL DLAALLTNLEELDVLFIDEIHRLNPAVEEIL 44 20 45%
2401 VLA-29-IDL VLATNGDTHLGGEDFDQRLIDYLVDEFKKEQGIDL 47 30 64%
2402 AIA-26-GIA AIALGLAILALLLLAAPSLSALIALLTAAGIA 65 6 9%
2403 SLA-25-AIE SLAACEGALLVVDALQGVEAQTLANCYAAIE 45 13 29%
2404 VLI-27-ALN VLINGESGTGKELVARALHRHSPRAKAPFIALN 39 30 77%
2405 VAI-24-GLL VAIYHAPDINAFATGALRDTSLVAVSTGLL 59 18 31%
2406 GSI-24-LGV GSITKAAEQLHRVPSNVSTRLLALEAALGV 47 13 28%
2408 GLA-28-AGL GLAIRVAGAITEEKLETVREADAILLEEIAKAGL 100 22 22%
2409 DVL-28-LLA DVLAFDKLEAGKLILELIVAKLLVGLAEVVILLA 73 7 10%
2410 GLD-25-ALL GLDFPDAGINRIAGVPVATLAIPLALLGALL 69 16 23%
2411 IDL-24-LAS IDLPAADPERVRQEIEDVIGLDASEAVLAS 43 25 58%
2412 LGT-27-LGL LGTFIAGVLLAESERRHELEGAIEPFKGLLLGL 63 12 19%
2413 LNA-27-LLG LNALEGLLRELLLLNAHEDLVVTAGRDAADLLG 50 6 12%
2415 LSL-25-LLS LSLLLLFANGLIGLLLLLASSLLALLLLLLS 82 6 7%
2416 LAK-26-ADL LAKELKVPALALSQLLRGREIRFDKDLLPADL 53 11 21%
2417 VLG-29-LLD VLGGRAMEIVYDEADLDRYFREAVSVSNDSPVLLD 59 28 47%
2418 SVL-28-LSL SVLTRPDTYDGVKPIAANRLQIVIVSAILPELSL 56 9 16%
2419 SIA-25-ELL SIAWSLFLPKGAGSVLVIGLDALDELSRELL 48 6 13%
2420 FLA-25-GLF FLAGVLLAESEYRHELESDIEPFKGLLLGLF 41 24 59%
2421 LSL-25-TGL LSLPGLAGEAVGIAGIDGLGTSELAGAITGL 56 11 20%
2422 GAG-27-EIA GAGGMRFYHPEYLRRLRALCDRYGILLIADEIA 46 25 54%
2423 VGI-29-NLL VGIARALALRPSLGIADELVWALDVSINLGILNLL 38 14 37%
2424 GLG-28-AVL GLGFLWFNTYPAQVFMGDLGSLALGAALGSIAVL 75 12 16%
2425 IAG-27-LAA IAGVLIPNDKRVVIALTAVYGIGLLLSKKILAA 84 14 17%
2426 EAL-28-ALV EALELVDLGGLLDRKPAQLSGGQRQRVAIARALV 82 29 35%
2427 LVV-28-SAL LVVDDMLLFRDGLNLVLELEDSVPATASLSLSAL 59 11 19%
2428 LTG-24-GLS LTGITEPIEFSFIFVAPVLFAIHAVLTGLS 52 21 40%
2429 NLL-24-VID NLLDTPGHEDFSEDTYRTLTAVDSALMVID 40 27 68%
2430 IEA-28-GEI IEAARAGEQGRGFAVVADEVRALAEQTAESTGEI 40 26 65%
2431 EIL-24-LGS EILQVQTPSLINDDLEYKTMGTDISCNLGS 41 26 63%
2432 AAL-26-IAS AALAAGATASLADYLTASVRSAARNIALAIAS 72 9 13%
2433 ALV-27-VVL ALVIGTLALSVLVTLKDLAAAALALLGGILVVL 74 9 12%
2434 SGG-24-GLS SGGTITNQMRRLGASVDWSRERFTMDEGLS 47 29 62%
2435 VLD-29-GLA VLDGEGTEKPDTEEAALQQLFKASGALVTFYAGLA 57 8 14%
2436 ALA-26-AIL ALAALVRGAAILGADLRLLILVAGLAVILAIL 96 8 8%
2437 ALA-26-AGI ALAAGCTVVLKPAEATPLSALALAELAEEAGI 98 37 38%
2438 ALV-25-VLE ALVSPTPFGNPRRLTTGIDINRLSLILAVLE 55 28 51%
2439 GLS-29-LAL GLSGDAAALLLAGAGVGRATEQAIGALLRLAVLAL 94 9 10%
2440 ALG-29-GLV ALGSDTGGSIRAPASLCGVVGLKPSYGLVLRGGLV 78 16 21%
2441 LLI-29-NVL LLICAGEASLSLPSTLLLFAGIALAGGGAALANVL 40 13 33%
2442 GLA-24-AFL GLALKLALVPLLLAALTLGMGAAASVAAFL 56 2 4%
2443 GLL-29-VLL GLLDRAALLVIALAGGSAILAAVAAALVLLLAVLL 94 10 11%
2444 LIA-27-VLA LIAAAVTLKGVSLLAANAGHLLLELGLGGEVLA 83 11 13%
2446 VAL-27-ALI VALEGALALAEVSLIAAGGEFAPDLLAPQVALI 71 6 8%
2447 VAL-24-VSV VALADALNKLVANGALKKNPLKGMVAAVSV 49 20 41%
2448 IAG-27-LGG IAGILLASIGGIAIPMTGAGGLLIVIAAVVLGG 63 6 10%
2449 GIV-24-IGV GIVSGAGVAAKSVALFGVSRCAPAPILIGV 43 7 16%
2450 VLN-27-ATL VLNTDAEGRLVLCDVLTYVERFEPLAVIDVATL 39 19 49%
2451 GSL-27-SGG GSLGETHAEKIVKIMELALKLGAPVIGLNDSGG 47 18 38%
2452 IVA-24-VGI IVAITAAMPTGTGLDKFAKKFPDRDFDVGI 44 21 48%
2453 RIL-24-LTL RILIKLASTWEGIRAAEQLEKEGINCNLTL 44 23 52%
2454 LSL-25-LLP LSLFKSRLFTIGCLAGLLALMLLFGALLLLP 67 9 13%
2455 TLL-24-VLL TLLLGLPTLAFLGALGLALAVGLIRGGVLL 75 18 24%
2456 VLV-28-AAL VLVSLAEILAAGAALLARLLVLALGAAALAAAAL 100 9 9%
2457 DAL-27-ELL DALGEALLEGVRLLKTLELSAEGGNAAGYRELL 71 11 15%
2458 LLG-25-DLA LLGFENYADYSLATKMAENPVQVLLFLTDLA 62 16 26%
2459 AIL-24-TLI AILPLKGKILNVEKARFDKMLSSQEVGTLI 47 28 60%
2460 IAV-24-EVL IAVYDLGGGTFDISIIEIDEVDGEKTFEVL 44 23 52%
2461 LLI-24-DIL LLIADEIQTGFGRTGKLFAYEHAGIAPDIL 57 29 51%
2462 GLV-26-LLV GLVAPHLAATLTGAGYRYLLPLSVLIGALLLV 71 12 17%
2463 IGV-24-TIA IGVGGEALPDMAKSLAKRLLLEVDSAPTIA 38 6 16%
2464 LLL-29-VVL LLLDEPPAGLLLLARIELLLALLLLAVAVGVTVVL 93 3 3%
2465 LLE-26-ISA LLERAAKLSDELGGGSITALPIIETQAGDISA 48 30 63%
2466 IGL-24-ALT IGLTPGAYLNWLLVAGRLRVQTELNANALT 57 14 25%
2467 LSV-27-GDL LSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDL 44 27 61%
2468 GAI-26-GIS GAIQLAGSVKARKAGRHATSDWMEIEKERGIS 41 30 73%
2469 GDL-26-EIL GDLAALLTNLEEGDVLFIDEIHRLSPAVEEIL 40 19 48%
2470 AGL-28-LGA AGLQAAATALLLGAVVGAADVRAAAAEQAASLGA 107 17 16%
2471 LAA-29-VLG LAALAAGLLLLLAAVAIAGAGRGVGLKALAAAVLG 114 13 11%
2472 LAA-29-GLV LAAAAGLTAALVEAAAEIGVIRALGDAALAVAGLV 107 9 8%
2473 VLL-28-LGF VLLIGAAFGAALEGAAGFGAPVAAAAALLVLLGF 54 9 17%
2474 AIA-28-ELG AIADQARTIRIPVHMVETINKLSRAQRNLLQELG 55 18 33%
2475 GGG-25-AIA GGGLGARHVGMAIPALVIGGADFLGSARAIA 68 6 9%
2476 LLR-28-DLL LLRVLQARERADVGALERIARLARLITALSPDLL 64 2 3%
2477 VEL-24-ALA VELRNRLAAATGLRLSAGLVFDHPTARALA 73 18 25%
2478 EVI-28-AIL EVIALIRASETDDIARAGLMSRFDLSERQAQAIL 40 30 75%
2479 LGT-27-EAL LGTVFLPATKALAKEMLPIVDKPTIQFGVEEAL 48 14 29%
2480 LNA-28-ASG LNAKAALFAVKEVFEALGVELPVMISGTITDASG 41 18 44%
2481 NLA-28-VLV NLADDPAIERIFTPRMALTVAEYLAYEKGMHVLV 39 19 49%
2482 GSL-26-GFL GSLRINQKELQERMFKALGFTAEEAQEQFGFL 41 16 39%
2483 GLD-29-LGF GLDTPTSGEVILAGQDLSKLSEAARGELRNRKLGF 40 27 68%
2484 VLA-27-ITA VLANEQVIDGKSWRCGAPVERKEAPQWFIKITA 50 18 36%
2485 LAA-25-VLF LAAQMGYLPGMLWLLAGVVLAGAVQDFMVLF 58 25 43%
2486 AGI-27-LGI AGIALTALLAINAAVGAALIVAGGKVAYTPLGI 61 17 28%
2487 SLL-28-ALA SLLAAVGLLGVADALPALLSGGQLQRVAIARALA 111 21 19%
2488 LAK-26-ILL LAKSLNVPFAIADATSLTEAGYVGEDVENILL 51 26 51%
2489 IEL-29-AKL IELSSAQQTDVNLPYITADATGPKHLNIKVTRAKL 42 27 64%
2490 LLI-29-ILL LLIILLLLFGLVLIISLLIRGYLAQLIVLGLLILL 82 2 2%
2491 VLL-26-LDG VLLRIHHVIGELPTYGYRRVWALLRRQAELDG 52 24 46%
2492 ELI-27-GLI ELIARLAQKARAAGIHLILATQRPSVDVITGLI 43 24 56%
2493 IGV-29-AIV IGVTGGLFASGFSINLLTLLAMLLAIGLVVDDAIV 47 16 34%
2494 LLE-24-GVG LLETGIKVIDLVCPFAKGGKVGLFGGAGVG 49 26 53%
2496 AVL-29-ILV AVLAGLGLNNALLGNAGAAAGFALLLAADGPSILV 56 6 11%
2497 PLL-24-LVV PLLEKVVASGKPLLIIAEDVEGEALATLVV 61 20 33%
2498 GVL-28-LAA GVLGALGVLVGLALALGLALGAGAVAIAAAALAA 103 2 2%
2499 LGV-26-AIL LGVELKVNLAKAWWPKFVLVSIPLVGIDLAIL 60 8 13%
2500 AIV-28-LVA AIVEGLAQRIVNGEVPEGLKGKRVLALDMGALVA 60 26 43%
2501 GIV-27-GIA GIVGYIGSRDAKEILLKGLEKLEYRGYDSAGIA 46 28 61%
2502 VDL-29-IGV VDLEDAVKEGAADVVLATLTVSGKEKGSANLSIGV 37 16 43%
2503 LSV-27-LIG LSVAGLMMRFGGLLSLKDVNVALRPGEIVLLIG 54 13 24%
2504 GGS-24-LVA GGSIRQPAAFCGVVGLKPTYGRVSRYGLVA 64 26 41%
2505 SGV-25-SGV SGVISDPFFVTPEHSIRDALALMGAYRISGV 41 13 32%
2506 VLE-28-IAG VLEELDLSLELGEIAGLLGPSGSGKSTLLRAIAG 43 13 30%
2507 LVI-24-GVL LVIACPCALVLSIPVGIFNGFGAAAVAGVL 50 18 36%
2508 FLG-24-LGA FLGLIVPNIPSIGLGDTLRGLIPATALLGA 50 14 28%
2509 LAL-28-RLL LALLTAALAAILLLVLAGLLLLNLLLRAAVSRLL 97 6 6%
2510 LIA-24-LAL LIAALGRLGVLTASVIAVLGAAGLAVGLAL 95 11 12%
2511 VLA-29-ILA VLASQEVHDISVAIGADPVDGDLSQLRYGKICILA 68 19 28%
2512 IAA-29-ILA IAAGAPEDLIGWIDQPSGELSNALMNHPGIATILA 62 15 24%
2513 LLF-27-LLL LLFLFVLLSILLGEILGLLALGLLFRLLLVLLL 92 13 14%
2514 IGV-26-GKL IGVVEDTAAVGEACRARGFVEHVVAIRPVGKL 40 18 45%
2515 ALI-29-GLA ALIRAAVRLGALAAGRKGRAILLVLLKYAESIGLA 75 15 20%
2516 VLG-24-GID VLGLGNIGPLAGKPVMEGKAVLFKKFAGID 42 24 57%
2517 VVL-29-VVS VVLSAGLQGAGKTTSVGKLGLVLAEKGKGKVLVVS 47 10 21%
2518 VIA-29-LLI VIAALLAGSSVLFGAFLGHFALLSIIGFSLATLLI 54 3 6%
2519 RLL-25-LEL RLLLARLFLKPSNLLILDEPTNDLDVETLEL 69 24 35%
2520 LVV-29-ALK LVVDDVNPIVELLIRNLNAIGYESCTASQGLAALK 46 18 39%
2521 SVL-27-IVV SVLLVVDAFDGPMPQTRFVTKKAFAYGLKPIVV 40 26 65%
2522 PLL-29-LLA PLLVEIQALVDLSALANPARLAVGLEQNRLALLLA 96 18 19%
2523 VAI-29-AIL VAILDADKEGFLRSERSLIQTIGRAARNVNGKAIL 54 27 50%
2524 AIE-28-FLG AIEAEDLTKRFGDFTAVDNVSFRIPRGEIFGFLG 35 25 71%
2525 ALL-25-LGV ALLAGLALLLAGALLQLVLGRPLAAPRALGV 99 12 12%
2526 VLL-26-IGV VLLGDDIVAALGPALIQLIGTYEVLLLAVIGV 55 13 24%
2527 LLD-24-VLF LLDEPTNHLDIEAIAWLEEYLKGAKGTVLF 43 23 53%
2528 ALS-29-VLE ALSTRNDDPQAASRPWDKDRDGFVLGEGAGILVLE 50 30 60%
2529 VIA-29-SAL VIAVYDLGGGTLDILELRLSRGVFEVLATGGDSAL 58 11 19%
2530 IGG-27-LAA IGGEEGGIIAKGELATIMPALVAILHGFDGLAA 71 23 32%
2531 LVF-25-LVG LVFGILGSIITMWFSRHREFHADAGSAKLVG 44 10 23%
2532 EAL-24-LLD EALAAIAKARKKEIHHRIGNNLQVISSLLD 78 20 26%
2533 IEL-28-LLL IELIKGDLEILSVAQAIEIGLAALGVLLLGPLLL 52 4 8%
2534 VLG-29-LVD VLGGRAMEIVENEEDLEDYMTTAVKASPEHPVLVD 47 23 49%
2535 KLA-26-LDV KLAEEDPTFRVETNVETGETVISGMGELHLDV 41 13 32%
2536 SGL-27-AIV SGLLMVAKNDAAHQLLAIELKAKKSKRKYLAIV 45 15 33%
2537 GLA-24-LVL GLALASRLGAALGAIPALTAGLAGLGDLVL 83 10 12%
2538 LIG-25-LVV LIGVFALMYAFGFSINLLTLLALVLAIGLVV 56 21 38%
2539 VLV-29-VVI VLVNITAGFDLRLDEFETVGNTIRAFASDNATVVI 49 16 33%
2540 LEL-24-VEL LELTVRSANCLKAEAIHYIGDLVQRTEVEL 46 24 52%
2541 LLV-25-VLT LLVLDATTGQNALNQARLFDEVLGITGVVLT 62 32 52%
2542 AAL-26-LPL AALLSIPPSLLEAAALLGAGPLRAFFAIVLPL 91 25 27%
2543 SVL-25-LIG SVLTDPTMGGVSASFAMLGDINIAEPKALIG 53 24 45%
2544 GAG-24-GGS GAGGAGGSGGGGGGGGGAGGAGGSGGGGGS 83 37 45%
2545 LAL-28-GIS LALVIAAGILLLGAANSGQHLPGLLGLAALLGIS 57 7 12%
2546 ALE-24-EVL ALEQNLKPIVVVNKIDKPSARPDEVVDEVL 57 21 37%
2547 GLI-27-LIV GLIVAPPKAGKTVLLQNIAHSITRNHPEAELIV 53 24 45%
2548 VLV-28-IAV VLVALGTIGSLLIIALGLEASFAFAGLTDKEIAV 49 11 22%
2549 GIL-28-AVL GILKALGGYVPLDLSGAAERLAGILEDSAIVAVL 58 8 14%
2550 VVS-27-GSI VVSMGGMAASGGYWISTPADYIVANPSTLTGSI 35 22 63%
2551 PLL-26-VLL PLLAALIASHMGGRLALIASGAAGALGLSVLL 74 7 9%
2552 ALI-28-IAD ALILTPIVEAMVIALGFSSGALGPFVIAAGFIAD 48 18 38%
2553 AAL-29-GIG AALAAARMGAKTLLLTHNIETLGAMSCNPAIGGIG 75 19 25%
2554 SAL-24-SGG SALGRSGLNIENYENFIQTDAAINRGNSGG 51 36 71%
2555 AVL-25-GID AVLGLGNIGPLAGKPVMEGKAVLFKKFAGID 47 24 51%
2556 IVL-25-AVL IVLGILLGVFLLTLLGEGGLAAGAALLAAVL 62 1 2%
2557 DAI-29-LGT DAILPTLGGQTGLWAAAFLSAAGILDELTSGLLGT 37 15 41%
2558 SAL-27-LAT SALDAESERLVQQALGELMDGRTTLVIAHRLAT 57 27 47%
2559 LIV-28-VLG LIVNTASKCGLTPQYEGLENGYKAYADRGFVVLG 52 16 31%
2560 TLL-26-LGA TLLALAAAVAAAVLITVADRSDLVAILGLLGA 67 7 10%
2561 KLA-26-LLP KLAAAVLVAIFGARFIWTGLDVLKLYAEGLLP 46 10 22%
2562 ADL-24-VGI ADLLVVAVGKPGFIPGEWIKEGAIVIDVGI 39 14 36%
2563 LGL-27-ASL LGLLTVLLLLGAPLAAVAAAFVIALLAGFKASL 81 10 12%
2564 LGS-28-GLG LGSLKALGLDPLVHDIRFVEDNWENPTLGAWGLG 55 26 47%
2565 LLI-25-VLI LLIGGVLLSVLILGGLLLGILILGAGAIVLI 58 5 9%
2566 VLS-25-TGL VLSGKQIYKVMAKFVGKLFGINFALGIATGL 45 7 16%
2567 GEL-27-GVS GELSRLMLALKSAFSRKEGKTSILFDEVDTGVS 41 20 49%
2568 RLI-26-ILL RLIGAPPGYVGYEEGGQLTEAVRRRPYSVILL 43 20 47%
2569 GSI-27-FLL GSIRIHRTEMQEKVFEVLGITEEEAQEKFGFLL 37 26 70%
2570 GLA-28-LGA GLAAVALAKGLGLIIVIPLDASGEKLDLAAALGA 95 17 18%
2571 IAA-27-LSG IAAAKAAGAHDFILALPDGYDTVVGERGVKLSG 68 21 31%
2572 GAG-28-ELA GAGPIGLAAAAVAKHVGARNVVITDVNEYRLELA 64 18 28%
2573 ALG-29-LLK ALGLSLFAAFFRIVLPQPVRHALPGLGNQWLVLLK 57 17 30%
2574 AEI-26-EGL AEIVKPQRYLPTTTEFVDIAGLVAGASKGEGL 39 19 49%
2575 GGS-27-DVL GGSAGGYLGGGDINKAPEKFAIPRAKVPFVDVL 41 25 61%
2576 DLL-29-AVL DLLIVSQPTRGLDVGAIEYIHKRLIEARDKGKAVL 61 15 25%
2577 IAG-27-ILV IAGLEVERIINEPTAAALAYGLDKTDKDEKILV 45 35 78%
2578 IGA-24-ADL IGALPVAAARSEGVLVGYLPGLAMLRIADL 48 14 29%
2579 AFL-24-ALL AFLPHIEDGTITFIGATTENPSFELNSALL 75 27 36%
2580 VIE-27-ALL VIEMIGITKAFGGFVANDDINLVVDKGEIHALL 50 15 30%
2581 LTL-24-IAS LTLAQLDVLEEDTAELAEIAIKIVVKVIAS 48 6 13%
2582 LID-28-ALE LIDCPPSLGLLTLNALTAADSVIIPMQCEYYALE 47 24 51%
2583 TLA-28-LLK TLAKSLNVPFAIADATSLTEAGYVGEDVENILLK 50 27 54%
2584 VSV-24-LLL VSVGAFASDPARGMFILAFLLLVIGGSLLL 56 10 18%
2585 YGL-24-SGG YGLAASQLLRLRARGIPLTVGVDKVAASGG 38 21 55%
2586 LSA-26-LLT LSAGREAMNEQLQALCFMAGANSIFYGCKLLT 66 33 50%
2587 IVL-28-ELV IVLPTGAGKSLVIAALARGARGRVLVLAHVKELV 40 10 25%
2588 FLL-24-ILL FLLSFGVLRLLGDVLAIPTLVGLGIVRILL 67 8 12%
2589 LGS-24-LGA LGSLKALGLDPLVHDIRFVEDNWENPTLGA 56 23 41%
2590 LLL-26-AIA LLLLIGALGLISTGNVFLVEAAAGAAVAAAIA 95 14 15%
2591 IAL-27-AIG IALIQIINPKLLTAIKLALSDALRVGALAVAIG 58 10 17%
2592 LGV-25-IGA LGVQKGDRVLIYMPMIPEAAIAMLACARIGA 56 23 41%
2593 IVA-27-GGI IVAGVGVPQLTAIANVAEAAKKTGIPVIADGGI 46 25 54%
2594 VLF-25-GLL VLFLLGAFLAGLNALGPGYAGAGALGAVGLL 51 18 35%
2595 LAL-26-LGG LALQGSLGALAADLALALDRALAAGLAAALGG 91 7 8%
2596 AAL-29-TGL AALAAALGAALLALAAQGIAIVLVAGAALAGLTGL 79 2 3%
2597 LDL-24-LGF LDLYGKVALLHYFSDNLVLDGADTYLRLGF 40 18 45%
2598 LGF-26-IAV LGFLWFNTYPAQVFMGDVGSLALGGALGTIAV 40 18 45%
2599 SIA-28-IGS SIAKATGRKYVRMALGGVRDEAEIRGHRRTYIGS 37 31 84%
2600 LLA-28-DLI LLARALLARPQLLVLDEPTQGVDVNGQVLLYDLI 56 14 25%
2601 ALS-28-LDL ALSGGERLRLLLAAAGALGTALLVLDEPTNHLDL 59 16 27%
2602 IGL-24-ELA IGLAVPQAARIAGAARIIAIDLGSPEGELA 51 21 41%
2603 RLL-27-ISA RLLERAAKLSDELGGGSITALPIIETQAGDISA 46 29 63%
2604 GAL-27-GLA GALKNIIAVAAGALLGLGFGDNAKAALITRGLA 84 19 23%
2605 GGG-27-LSA GGGYAQVLPMEDINLHFTGDFHAITTANNALSA 58 19 33%
2606 LTG-29-LDI LTGLTNRRHFAEQLEGEGIRARRARHPLALAMLDI 42 20 48%
2607 DVL-24-ISA DVLAHRLGPTYGVAILSLSVRILEGSLISA 39 7 18%
2608 IGA-25-LLV IGASLFVGLFAAIALAGPAFLLLSAVAGLLV 60 18 30%
2609 LAK-25-LLG LAKRMGKKEIIAETGAGQHGVATALAAALLG 60 18 30%
2610 SLA-27-AIG SLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIG 55 12 22%
2611 AGI-26-LGG AGIILASRLGSAQPTTGTGYELDAIAAVVLGG 63 25 40%
2612 IVL-25-IGL IVLGIDNIVFGLILGVKLPPIIADIAVSIGL 56 8 14%
2613 DVL-26-NVL DVLDGGEGSNRLEGGAGNDVLKVSYWSADNVL 37 22 59%
2614 SLV-26-LLA SLVAALAMGALSLAVIYLLAIALAAVILALLA 82 9 11%
2615 NLL-25-LLA NLLAGLLLLKELLALALEGLELAAAALLLLA 70 6 9%
2616 AIS-29-DVL AISDVSHISCVSNDFGIAAVFSRYVEAVGREGDVL 37 12 32%
2617 GKL-27-AIA GKLEIIAHVACNNTKDLSEAAAPGVALGVDAIA 48 18 38%
2618 IAL-26-LLL IALLAPGPASLTGGLALELLGLGGLVGLLLLL 101 11 11%
2619 ALG-26-VAL ALGERTITLDCDVLQADGGTRTAAITGAGVAL 93 23 25%
2620 VLV-26-VLG VLVILGGAGLLGGADTLALIRYAEGEDLLVLG 61 5 8%
2621 GVG-26-TGL GVGIPAAELVRLFEPFFQVDTSVQRNFGGTGL 46 16 35%
2623 VLL-25-AIV VLLLGEPTNALDLEAREALQLLLQKAIHAIV 64 8 13%
2624 TLA-25-GVL TLAGTEVSALLGRMPSAVGYQPTLAEEMGVL 60 20 33%
2625 PLL-24-GLG PLLCAGITTYSPLRKWNVGPGLGVAVIGLG 65 18 28%
2626 DLV-27-GGS DLVERTLTPVRQALSDAGLSLSDIDEVILVGGS 40 21 53%
2627 VSV-29-GIL VSVVDLTVILKKATTYEEICAAMKAASEGKLKGIL 39 20 51%
2628 VLF-25-VFL VLFAGWSSNNKYSLLGALRASLQTFSYEVFL 37 11 30%
2630 AAL-24-LAT AALLAALAELGVLLGGLLFAAAALLAALAT 98 6 6%
2631 LAA-26-DLA LAAIKMAKDAGVTAVISHRSGETLDATIADLA 91 14 15%
2632 LID-26-DAL LIDKNGIVRHQVVNDLPLGRNIDEMLRLVDAL 56 21 38%
2633 IGG-26-ILL IGGGLLAMSLFTLLAPVNLALAGVVLATGILL 53 11 21%
2634 LGS-26-LVL LGSVHGPYLGEPVLGFDEAELIGAFTGLPLVL 66 13 20%
2635 VLG-26-ELG VLGYQLAGVLIGPSGLGFLGDLVAILHLRELG 49 24 49%
2636 LDV-24-ILV LDVGGGASKEKVTEAFKIILADPLVKGILV 37 14 38%
2637 AVL-28-LPL AVLAGALAALALVLGPLLALLFVLRDMALGSLPL 74 11 15%
2638 LGA-29-LGV LGAGLGWAKSILFNLRARDAFAAFFARTDLVALGV 81 24 30%
2640 GLG-26-VIG GLGVLGWGVGGIEAEAAMLGQPVSMLLPEVIG 54 13 24%
2641 LGG-27-VLL LGGRAMEIVYQEADLARYGREAVSVSNDSPVLL 80 22 28%
2642 TLA-26-GIS TLAAQFNRPGHEIVDHLTYVFMGDGCLMEGIS 45 16 36%
2643 NAL-28-GIG NALIPVVTVAGLQFGALLGGAVVTETIFSWPGIG 40 30 75%
2644 IAL-24-LDL IALAFPGPNSFTDEDVLELQGHGGAVILDL 54 9 17%
2645 VIA-25-VLI VIADLSAAIWIAFGPAPALLLALVNATAVLI 46 7 15%
2646 RLL-24-GKL RLLSLLSAFEVVVWMTDGWPLYESRLKGKL 44 35 80%
2647 EAL-27-GLG EALPGLVNGATITLITLVGYSAMAGAVGAGGLG 63 27 43%
2648 GAL-29-LVV GALVAFLAGLVPPFAAFAPRVNRILLGLSLGVLVV 64 13 20%
2649 LSL-26-ALG LSLNSAAYASEILRGAIKAVPAGQWEAALALG 80 30 38%
2650 ALA-27-VLN ALAFKIATDPFVGKLTFFRVYSGVLNSGDTVLN 56 31 55%
2651 GLG-26-ASL GLGLALLALLLILLAGIPILAAVGVGLVFASL 67 8 12%
2652 AVL-25-LGI AVLPGAFKIKAGKLRGEASEGGLGSFAELGI 66 12 18%
2653 LGG-27-LLI LGGAVIAMFGMVAALGLDMLISLDIRKQENLLI 60 14 23%
2654 VGL-24-LLG VGLGAVAGKRLGGFSLGMGQRLGLALALLG 74 16 22%
2655 GSL-28-TLA GSLLLDIALGVGGLPKGRIVEIYGPESSGKTTLA 49 13 27%
2656 FLA-29-GFL FLAVTLAVTALKRGQVKRIILTRPAVEAGESLGFL 39 22 56%
2657 LLL-26-VLI LLLDEPINHLDAELIEWLLRYLLAYVGAFVLI 81 15 19%
2658 LLA-25-LVI LLAEAKVPYDIVLEMDEINDDFADTDVVLVI 69 23 33%
2659 LGV-24-RIL LGVELVKRYIKTIGLTNSGAEFLIKTCRIL 43 10 23%
2660 GLA-29-SLL GLAAALAIFPLAPLLALLVLEGAIALRVLAGASLL 74 6 8%
2661 LEL-26-GLI LELAGESHVLRFLMGLIRSGATLSKKRLAGLI 44 14 32%
2662 NLL-29-LLE NLLEDKNSDVRVAAALALGGIKKEAAIPGLIELLE 58 13 22%
2663 LAT-28-VLL LATTIKAAKKMVEREEAVVWDILLEVIREHPVLL 66 17 26%
2664 AFL-25-LLS AFLPHIEDGTITFIGATTENPSFELNSALLS 60 27 45%
2665 IAD-28-FLA IADRPGLAPGLIGGMLAVSTGAGFIGGIIAGFLA 35 24 69%
2666 GIT-28-GIG GITDLITTPGLINLDFADVKTVMANAGNALMGIG 39 19 49%
2667 LLL-27-VAI LLLSALATVTLAHARTAALSGVAAAADILLVAI 67 10 15%
2668 ALL-28-LGT ALLHSLGVQEGRNGALIWTLLLAILAFSLSLLGT 67 20 30%
2669 LVE-24-GAS LVERLSDARRNGHRVLAVVRGSAVNQDGAS 46 29 63%
2670 VLI-24-ISA VLIQRNAYVDLVQGSVADVAGSPQQATISA 42 13 31%
2671 VLV-24-LIA VLVGGAGSGFLGSVMAYAALVRKLTKLLIA 57 6 11%
2672 SLG-26-GSG SLGADGAFAKHGDTFYKVPIPKIKVVNPVGSG 44 18 41%
2673 GGG-26-ALS GGGGGNVLPMEDINLHFTGDFHAITTANNALS 66 14 21%
2674 GVV-26-IGG GVVSRSGTLTYEAVGQLTEEGPGQSTAVGIGG 45 18 40%
2675 LNA-28-GAG LNALNAETLAELSAALDGAEADDDVRAVVLTGAG 45 21 47%
2676 VFL-25-ALL VFLCLAALYESWSIPFSVMLVVPLGVIGALL 57 32 56%
2677 IAL-25-AAL IALALAAAFDLRKVVPLLIIQVAGAFVAAAL 106 13 12%
2678 LSG-25-EGL LSGGEQQMLAIARALLTDAPLLLLDEPTEGL 47 38 81%
2679 ALG-27-NAL ALGLNGARAGALADALLGSDTLLSPAAAEFNAL 54 8 15%
2680 AIA-25-ADL AIAEKRAVALEATEAGFKVGTAEEAIPQADL 66 10 15%
2681 LAE-26-ALL LAEAVNLLAAAALLRRKALEDEGVIGLLVALL 106 10 9%
2682 LLP-24-ITA LLPLDLEDFVPENHIARVLNDIVDVVDITA 41 10 24%
2683 VVS-27-GIV VVSRRAVIESENSAERDQLLENLQEGMEVKGIV 39 21 54%
2684 SGI-28-LAA SGIPLALLDLALSVRDAAGSLKVGAGADAELLAA 57 13 23%
2685 AVL-29-LGV AVLLSALATLVSVLLATALVAPVAATLAAMLELGV 78 9 12%
2686 LLI-29-VLE LLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLE 44 11 25%
2687 LAK-28-LNA LAKLAGGVAVIKVGAATETEVKEKKLRIEDALNA 49 25 51%
2688 LAI-25-LPL LAIRDEVADLEAAGIKIIQIDEAALREGLPL 55 19 35%
2689 IGV-27-VAI IGVPVVSKALIGLDSLLSIVQMPDGIPVATVAI 41 19 46%
2690 IAD-29-GLL IADRVAVMYRGIIVELGEVASRFQLPDHPYLYGLL 43 20 47%
2691 GLA-26-LDG GLAERALFRILLLIEINNLLARKQGALLRLDG 53 10 19%
2692 GAL-27-VIL GALVAGAKYRGEFEERLKAVLNELAKSEGNVIL 51 18 35%
2693 VGL-29-LDA VGLTPFPILEIVRRLVARGGIEGYTALLARATLDA 52 14 27%
2694 ELV-27-ELA ELVPALGGVSIVELVGAFVVGPETITLTLEELA 56 11 20%
2695 ISA-28-LVE ISAASQEQSAGIEQVNQTVTQMDETTQQNAALVE 45 28 62%
2696 LGG-27-ELL LGGKAQFGGQRFGEMEVWALAAYGAARHLRELL 57 17 30%
2697 TLG-25-ELA TLGQEFSGYAAQLEHGLKRIEESLPHLAELA 50 26 52%
2698 LLA-27-ILL LLALLALRLGVALGAQAGGVLVLFIGFIGLILL 87 6 7%
2699 ALG-28-SAL ALGLSGGQQQRLCIARALAVAPEVLLLDEPTSAL 78 20 26%
2700 AGL-27-GSL AGLAAGLALGLAGKRLAILIAGQQALALASGSL 69 15 22%
2701 GLI-27-LAL GLILGLSGGLTVVVLILFALGIIELSGLVFLAL 81 5 6%
2702 LVS-25-LLL LVSVLAFLSDLARGMFILAFLVAVIGGALLL 74 10 14%
2703 LIA-28-DLL LIAGAPAPERDLLILDELTGALGVLTHGQFTDLL 59 19 32%
2704 LGV-27-AIV LGVDDGVDYCHSGRLRRIDEAAISALLINGAIV 55 9 16%
2705 GVL-27-GIG GVLFGLLYGTGIRYWGFMAGPKAFAAAVLGGIG 55 16 29%
2706 SGG-28-GLG SGGVMLPNHSPLVIAEQFGTLETLYPGRIDLGLG 51 29 57%
2707 IVG-27-GID IVGPTGAGKSTLIKLILRLYDPLSGEIFVDGID 39 19 49%
2708 GAI-25-AAI GAILPIYDALYDGGVEHLLCRNEQGAAMAAI 53 12 23%
2709 VLT-28-GLA VLTSNAFAILGLRAMGFLLAGVAGRFILLGYGLA 57 12 21%
2710 NAL-28-SAL NALHGVLIEADLSRGDLEALAIGATGSGVLASAL 46 6 13%
2711 LDV-29-LVA LDVTIQAQIIELLLELQQKEGMALLLITHDLALVA 46 20 43%
2712 GID-29-EVL GIDVGAKAEIYKLINGLAAQGVAVIMISSDLPEVL 42 26 62%
2713 LAI-24-ELL LAIIGENGAGQELLAKLLAGLFETLLGELL 52 12 23%
2714 ILG-26-VVL ILGKKVGMTQVFTESGELIPVTVIEATPNVVL 53 22 42%
2715 DAL-28-ILL DALPIEELNDVPYKSKNPGVMHACGHDGHTAILL 48 18 38%
2716 SLG-24-LVF SLGAVPFAAFLRVYLPLTYPGAGAGALLVF 39 13 33%
2717 DLI-28-LLI DLIVLSGLIHPSLDEMVNVDKEMARQGFGIPLLI 40 8 20%
2718 LGL-24-TLA LGLCPGMLVALGLLTAIGMGLATTFVLTLA 80 10 13%
2719 GAG-29-GLS GAGHFVKMVHNGIEYGDMQLIAESYDLLKDGLGLS 60 18 30%
2720 LLN-28-LAL LLNAVNALIALTFAAEPGLGARTRLLAVLLGLAL 62 6 10%
2721 LAL-24-IAD LALDAAHPVKDKWGQTSVTERDLILPKIAD 66 25 38%
2722 EAL-24-RIL EALVFAFEAGADEFRVRCALRGGFAPLRIL 49 13 27%
2723 EAL-27-FLG EALEKLQLNDASLQFEPETSQALGFGFRCGFLG 42 34 81%
2724 AVL-24-VIE AVLREIGVETGGSNVQFAVNPKNGRMIVIE 44 26 59%
2725 VLV-27-LLT VLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLT 59 21 36%
2726 RLL-28-TLG RLLAVSARGKVLIVALQVEQGVLGASEALGATLG 47 2 4%
2727 LLF-27-LTL LLFMGDIVGRLFREFAVTLAVAILISAVVSLTL 54 11 20%
2728 IAS-28-GIG IASSGLKLLIDSKVDLGLKKNLAIASVILVIGIG 42 13 31%
2729 ATL-29-LLR ATLVRNHRALIDLAALPRFTLVPKRAAEPLIRLLR 55 13 24%
2730 VFL-29-LAA VFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAA 54 14 26%
2731 LGL-24-LVF LGLRALYFLLAAVAARFSLLKYGLAVILVF 55 14 25%
2732 LEL-24-GLL LELALACLAGLCGDDSALGLGLPAVLLGLL 58 9 16%
2733 LTG-24-LAI LTGPVTILNWSFVRDDISRSAVARQIALAI 54 20 37%
2734 LAE-26-AIE LAERTALVGGVASVIDGLAEQENLLALNAAIE 53 17 32%
2735 AIV-28-VSV AIVDANLVMDMPKSLTAFGGLDALTHALEAYVSV 38 22 58%
2736 GSL-27-GLG GSLKALGLDPLLHDIRFVEDNWENPTLGAWGLG 52 26 50%
2737 IGG-27-VIV IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIV 41 17 41%
2738 ALG-25-GLL ALGAFLAGVLLAESEYRHELEAAIAPFKGLL 101 18 18%
2739 LGV-28-LAA LGVTGSGKTFTIANVIAQLQRPTLVLAPNKTLAA 103 44 43%
2740 SLL-28-LLT SLLYRLKPELCRLLMIDPKMLELSVYAGIPHLLT 72 17 24%
2741 LAI-26-GDL LAIAVNARGFPFLDGALDELLGFEVTAANGDL 40 5 13%
2742 LVE-24-ALA LVELAALALKEAAEARQGDLGTGALAAALA 89 4 4%
2743 LID-28-ADL LIDDLVTKGTNEPYRMFTSRAEYRLLLRHDNADL 44 22 50%
2744 GSG-27-GLL GSGPAGLAAAQQLNRAGHAVTVFERADRIGGLL 66 30 45%
2745 LGV-26-VFL LGVLLYDADAIEEAASTEVEVDLYERQLDVFL 43 14 33%
2746 EIL-26-GAS EILDSRGNPTVEVEVTLEDGSFGRAAVPSGAS 38 31 82%
2747 ALT-26-AAI ALTFVSSAVLIAADAADVRDLLPGGLTALAAI 59 2 3%
2748 ALL-24-VLF ALLEVLGPELNTLFLDHYLLVRIDLSAVLF 64 12 19%
2749 LEL-28-PLL LELASELGLALGHLGVACAALVLAASQHLWVPLL 44 14 32%
2750 IAA-25-GGI IAAGGELARLLDEAFKGAIIVSLGLGALGGI 56 2 4%
2751 IVG-25-IGA IVGAGKAEGAMDAGNILKPMLARGELHCIGA 44 27 61%
2752 IAS-29-AAI IASQVSVAAAGALATAADIAAVKAIAVVKVLVAAI 51 7 14%
2753 LVD-27-DLA LVDAITTFDQAKAVFYATAQASIDSRLAVKDLA 50 16 32%
2754 DLV-27-GEI DLVRWRADGNLEYLGRIDDQVKIRGFRIELGEI 40 24 60%
2755 GVS-29-GVS GVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVS 41 24 59%
2756 LTG-27-ILL LTGKAGLITGEDTGPALGIALTIAREGPGLILL 49 6 12%
2757 IVG-29-LVV IVGAGVGILAGGVSYRLELFIGALLTLALGLALVV 47 12 26%
2758 GEI-26-ALG GEIKSEAAIPGLINLLEHENSDVRYSAASALG 46 13 28%
2759 ALE-25-ALE ALEPHIDAETMEIHHTKHHQTYVNNANAALE 73 33 45%
2760 ELA-28-LVA ELAKKYKEAPQVVNAIAAHHADVERTSAIAVLVA 71 13 18%
2761 IAS-29-GVG IASDWNKPNGQFVITPAEVPAFLATLPVAKIPGVG 41 25 61%
2762 VLS-27-AIA VLSGNRNFEGRIHPYAKQAFLASPPLVVAYAIA 59 20 34%
2763 LVS-28-ALV LVSALLAALGFLILTGAAALLVVLLGGLLLSALV 60 12 20%
2764 GIL-24-ISA GILASFNMFGGGALLLKEIFILIIMAYISA 40 13 33%
2765 IVG-28-GLL IVGIGPTGKTTVTGVEMFRKLLDEGEAGDNAGLL 58 13 22%
2766 GVI-27-DAI GVIVQYGGQTPLKLARALEAAGVPIIGTSPDAI 35 21 60%
2767 ALA-25-GAI ALAAAMALAAGFAFVVVGAMGLAWLVGLGAI 80 11 14%
2768 AIA-27-LAL AIARALALLPVILLGDESTSALDVLTVLQILAL 97 16 16%
2769 LGF-27-AFL LGFILAASGLAVGGGDIWGFVSVVATNGGLAFL 43 17 40%
2770 IAD-26-TGL IADNGSGISEDAKQKIFDPFFTTKEVGKGTGL 38 15 39%
2771 LGT-29-FLL LGTSLLTSLIESAAGVAAGGRTGLTAWVVALLFLL 38 15 39%
2772 GDL-27-LVS GDLLGSVGAIGAALIIIITGWTAADPIASILVS 39 12 31%
2773 TLA-27-AGI TLALAEAGANGAPVVDEAIQGVKILMMGILAGI 58 12 21%
2774 GGI-25-GLG GGIASAGAVAVARIFGAKGGIPARLSLYGLG 49 9 18%
2775 EAL-25-ALK EALAAAFSDSKSLLVLGAGAQVPGALEGALK 64 7 11%
2776 GAG-27-LVA GAGTITCNYDGANKFKTIIGDDVFVGSNSQLVA 72 35 49%
2777 TLA-27-ASG TLAAVHTLGIPVDLPTALLLSVVAAVCACGASG 59 21 36%
2778 IDL-29-VVS IDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVS 35 15 43%
2779 SIA-28-GFL SIADRPGLAPGLIGGMLAVSTGAGFIGGIIAGFL 37 25 68%
2780 VLN-29-SGG VLNMMNQDGVRNGYDLAQLKKVRAVCHVPLIASGG 35 21 60%
2781 ALA-26-ASG ALAAALAAGADAAVSGVAGGAIALLAAAGASG 92 5 5%
2782 TLL-24-VLA TLLRLDTPISERLGLALAAAAEAGVPAVLA 74 3 4%
2783 LLG-25-GGS LLGRDPVELDEELISANITGKTVLVTGAGGS 54 28 52%
2784 LSL-26-GLD LSLGQRMRADLAAALLHNPKVLFLDEPTIGLD 45 22 49%
2785 LGG-27-EIL LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEIL 43 32 74%
2786 IAG-27-IAV IAGLEVKRIINEPTAAALAYGLDKGGGNRTIAV 56 24 43%
2787 GVI-26-FGL GVITVMMIFAGRTKRSFFQVDDFIAPLIPFGL 38 12 32%
2788 IPL-26-AIG IPLSLLGALILMIAMGFSLNLLTLLALVLAIG 40 21 53%
2789 IVD-29-TLL IVDFLKDPKKYAELGAKIPKGVLLVGPPGTGKTLL 37 24 65%
2790 IAL-27-ALV IALSGLLKLGLIFYVHAMAYLAGELKRGFLALV 71 8 11%
2791 ALS-25-LPL ALSELYLVEGDSAGGSAKQGRNRKNQAILPL 63 21 33%
2792 LSG-26-IGG LSGLITPSLDEMVHVAKEMERQGFDIPLLIGG 51 27 53%
2793 AGL-28-LLP AGLLYLLAGALLLAGLARLALLALAAAALLALLP 69 1 1%
2794 LSV-25-DLL LSVPEGEDKKLKYPHMFAAAGLSLLEKVDLL 44 8 18%
2795 GVI-28-LVV GVIGAGLFVGSGLAIAAAGPAVALAYAFAGALVV 50 17 34%
2796 ADL-24-LLA ADLAALLAALRRVLLGADKLLAGLVAALLA 83 1 1%
2797 FLG-26-ALV FLGSARFPEFGAAVIRAMAIEILKKLGIDALV 48 13 27%
2798 GIG-26-RIL GIGKGHLVYEIDALGGAMAKAFDQAGIQFRIL 37 15 41%
2799 VLA-27-IAA VLAGYPSVDVRVILYDGSYHDVDSSELAFKIAA 92 24 26%
2800 AIL-29-IGA AILPLRGKVLNTAKAKMADILKNEEINTLIGTIGA 56 19 34%
2801 VSL-26-LLE VSLAVPAGGILGVIGASGAGKSTLIRCVNLLE 51 13 25%
2802 GIV-28-IVL GIVAGGGTALVNVYPKVAALEAEGDEATGRNIVL 43 17 40%
2803 FLL-27-LLV FLLPGYFLLVLQPLLGLLLAASLGVGVALLLLV 62 6 10%
2804 IAV-29-AAL IAVGFAGIALLRVLAAIPSAAALLRAAVAATAAAL 73 3 4%
2805 LAT-26-AGL LATGGYGRAYFSATAAHTLTGDGGGMVLRAGL 70 13 19%
2806 VAI-27-VLE VAIARALAMRPEILLFDEPTSALDPEMVKEVLE 42 25 60%
2807 IAG-24-GIA IAGLEEISSGEILIDGEDVNDLAPSKRGIA 54 23 43%
2808 IGA-24-GVV IGAWIINKLSSGKIAFLQLADGQGFVQGVV 53 9 17%
2809 VLA-24-ELL VLAQAPGIILLDEPTTALDISAQILLLELL 70 12 17%
2810 ADL-24-LIV ADLDAAVAAIVFGAFFTAGQRCTAGKRLIV 42 17 40%
2811 DIL-26-VGL DILPMTLEIAVLFAKVIPGDTLKLSGLGPVGL 40 13 33%
2812 VSV-29-DLI VSVVQLPNDEMKGRIIGREGRNIRELETLTGIDLI 36 15 42%
2813 VLL-25-LLS VLLAGLALALGVEGLALPLAKLLAVVPLLLS 86 8 9%
2814 LLE-28-TLL LLESELFGHEKGAFTGALTTRLGKFELAEGGTLL 62 15 24%
2815 ALA-26-GVG ALAILSALAPAELANAIAEEDLAGLSVGPGVG 82 16 20%
2816 ALE-24-GVG ALEVVLTVLHAGGKFDKGSYKVSGGLHGVG 45 22 49%
2817 LLK-29-LAK LLKQSGTFRENEEVAERAMDSNDLEKERGITILAK 52 25 48%
2818 LVG-28-GAG LVGAALAMSGAVGQAGFLNPLAEPGLLGASNGAG 63 20 32%
2819 PLL-26-LSL PLLIQILALVAGLPIAGLGLAALGAALILLSL 66 6 9%
2820 ILD-28-ILV ILDEPTRGVDVGAKKEIYQLINEFKADGKSIILV 39 9 23%
2821 SIA-26-IAG SIADRPGLAPGLIGGMLAVSGGAGFIGGIIAG 41 26 63%
2822 NVL-29-GVS NVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVS 33 18 55%
2823 ALE-27-ALA ALERVGLAALADRQIGALSGGQRQRVSIARALA 99 38 38%
2824 ALS-28-LLG ALSAVVLELALRGVVALASAGAGVGAAVLAALLG 80 8 10%
2825 AGL-27-GSG AGLGQNPARQAALKAGLPLKVPAFTINKVCGSG 61 22 36%
2826 GIS-28-GAG GISKSFGGVKALDDVDLAVYPGEVHALLGENGAG 44 25 57%
2827 GVS-29-AIV GVSLESLELIFAAFYRTDEARLRELGGAGLGLAIV 41 8 20%
2828 VVI-25-AVL VVIGGVQGAVFMIIVLLGTSAEGLEVALAVL 52 1 2%
2829 EIV-24-SGG EIVEKSLKGAALWDEVKDRLHKSALGLSGG 37 35 95%
2830 LTG-28-LID LTGLGNRRLFDERLDEALDKAEREGQSLALLLID 44 21 48%
2831 LLV-24-LVE LLVIDESHVTVPQIGAMYKGDRSRKETLVE 51 19 37%
2832 AVL-24-ELG AVLPGDFKIKKAKLRGEASEGMLCSASELG 57 22 39%
2833 IGA-27-TLG IGAAIQGGVLGGEVKDVLLLDVTPLSLGIETLG 47 20 43%
2834 GVS-27-GLL GVSLLVKPGELLAIVGENGSGKSTTALLIAGLL 55 28 51%
2835 LGI-26-LFG LGILAHSALSLGLVVLSLMSNVRVDLMAYLFG 50 19 38%
2836 LLT-27-IAS LLTSMDRDGTKSGYDLPLTRAISDAVDIPVIAS 45 36 80%
2837 ISA-26-AAL ISAASQEQSAGIEQVNQAVTQMDEATQQNAAL 69 25 36%
2838 GGS-24-LAA GGSVTAGVAIVDTEKHLRADVLTEALALAA 69 14 20%
2839 GLG-26-LSL GLGSLPSGLALLAAAAIGAAAAGALLIVGLSL 65 8 12%
2840 GAL-28-VLL GALAAGLKAFALRAAILVAQGLALGGLLVRDVLL 80 6 8%
2841 GAG-29-GAS GAGLVGLARLSDARRGGHGVLAVVRGAAVNQDGAS 60 14 23%
2842 GGS-24-GSI GGSTRNGRDSEAKRLGAKAAGGETVLGGSI 44 27 61%
2843 LLA-27-TLG LLAFARRQLLAPAAVAVNILVLGLQKLLARTLG 69 11 16%
2844 SGL-26-TLG SGLMVGLGETNEEIIEVMRDLRRHGVTMLTLG 44 19 43%
2845 GAG-29-LPL GAGNLIFPPLLGQLAGENVWPAIAGFLLTGVGLPL 55 26 47%
2847 IGA-29-AIL IGALLATTLRGLSNDVYFQVGLLTTIGLSAKNAIL 57 21 37%
2848 PLL-25-GLL PLLLARLLNLAAAQAGALNIAVLTADLAGLL 75 13 17%
2849 GVI-28-VIE GVIVAMTLEEAEAAVRDMLAGNAFGDAGSRVVIE 38 22 58%
2850 VVI-28-ALG VVIDDADMSIEAVARGLDHIANTPLQLAIGEALG 50 8 16%
2851 TLG-26-GAI TLGVLITAGLTGMMAAWLFNLDLIEGLLIGAI 42 8 19%
2852 RIL-25-TLL RILIKLASTWEGIRAAEQLEKEGINCNLTLL 44 22 50%
2853 LTI-27-AIT LTIAGSDSGGGAGIQADLKTFCAYCVVGLSAIT 37 19 51%
2854 GLG-28-EAI GLGTRDLPATKGLPKEMLPIVDKPTIQYAVEEAI 47 15 32%
2855 GAG-29-VIA GAGLGGGHDEREQTLNQLLVEMDGFEGNEGIIVIA 64 36 56%
2856 GSG-28-VLV GSGPIIIGQAAEFDYSGTQACLALKEEGYEVVLV 55 26 47%
2857 AGL-25-VLA AGLLAAGLAALIAAVRAALLGRLALLAAVLA 100 1 1%
2858 IVA-26-VIE IVAMTLEEAEAAVRDMLAGNAFGDAGSRVVIE 36 20 56%
2859 GGI-27-RIL GGIGKGHLVKEIDALGGAMAKAFDQKGIQFRIL 38 16 42%
2860 FGL-27-VLG FGLLGPNGAGKTTKQGILLGLLVPTSGVAAVLG 47 13 28%
2861 TLL-28-LLL TLLLLLLALLLGAIAVVVGASNIVLRPMVLELLL 108 14 13%
2862 AIL-28-AIL AILDADKEGFLRSERSLIQTIGRAARNVNGKAIL 66 24 36%
2863 ALV-26-AIG ALVPDASPISLSGIIFYNTLFDENASNHLAIG 59 17 29%
2864 IGL-25-LGG IGLLPGYATIGIFAPLLLALLRFGQGLGLGG 58 24 41%
2865 IVA-25-GIA IVAITAAMPKGTGLESFAKAFPDRIFDVGIA 49 20 41%
2866 LAL-26-IVL LALGIAALGLIFRLLLALVGALAGIIGGAIVL 73 3 4%
2867 LVL-28-VLV LVLVAIGGVVLVGFTLALLFLLLVLAAALALVLV 74 4 5%
2868 LGA-24-GLL LGAFLARVLLADLLLRAELLLAVGALAGLL 92 5 5%
2869 LDG-27-IAG LDGVALELGKGEFLALIGPSGSGKSTLLTIIAG 41 14 34%
2870 LIA-28-ALI LIALFPLLALDLVIPALIAAALLALGGALLVALI 71 8 11%
2871 VLA-26-AIA VLAFPGAFSGALLALAAAITPVMKLAAAEAIA 87 15 17%
2872 GLA-26-ALI GLAGLANAAALLALGLLVGVLAGLVIAAPALI 77 12 16%
2873 ELG-25-VLT ELGRQVIKALLIRSGVPASEVDEVILGQVLT 43 12 28%
2875 VSG-28-ALI VSGFLIRIPLDIFIAAALLTGYEGLGIAGIRALI 45 10 22%
2876 GVS-28-LLP GVSFALAGGEGLALLGESGSGKSVTAHAIAGLLP 44 20 45%
2877 VLS-28-VLS VLSAVFVKMAFFGGTTGAGYRQFSITIVAAMVLS 49 8 16%
2878 LDL-29-EAL LDLKLRTEMQYELRELQQRLGITFIFVTHDQEEAL 66 32 48%
2879 ASG-25-VLD ASGKLGGGKATLGANLAAAAARNGAGLAVLD 46 7 15%
2880 LLA-25-VLF LLAVLLAGGDFEERLFAGVLEQEGAPAAVLF 63 10 16%
2881 SLL-28-ELA SLLASPLDLRIETRLDAEVKLWLAFALQKCLELA 64 10 16%
2882 LGV-25-LVA LGVALLVLLNDAVAAAEIKFADNATGAALVA 73 6 8%
2883 SAL-26-LLA SALGVALFRLAGLAAGADDGLLGALAAAELLA 106 10 9%
2884 GLG-28-GEL GLGLLLECDQIEKSISSYVGENKEFERQYLAGEL 49 13 27%
2885 IAV-29-IGL IAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGL 51 31 61%
2886 DIL-26-AIA DILTLEAFELASLVDMALGGSTNATLHLLAIA 45 14 31%
2887 GIE-28-VID GIENYSRHLDGRAPGEPPPTLLDYFPDDFLLVID 35 20 57%
2888 VAL-29-LGV VALHAVAEAQKAGGIAAFIDAEHALDPAYAAALGV 72 26 36%
2889 VAL-24-LIE VALLPSRYQKEAERILKVLDLVEQNLKLIE 50 20 40%
2890 GVL-28-IGL GVLFTLISATGIRSWILRNIPHGLAHGGGIGIGL 58 12 21%
2891 AGI-29-IAL AGITLLILAAFALGGGGLALAGLIFLIALLAAIAL 55 4 7%
2892 GGG-29-AIE GGGVTLSGGEILAQAEFALAELKFAKSEGVHTAIE 39 15 38%
2893 LLR-28-LGI LLRGIPEKNAKAHRGAWNKSAAGSFEARGKKLGI 49 18 37%
2894 DVL-27-LDG DVLLRIHHVIGELPTYGYRRVWALLRRQAELDG 47 24 51%
2895 IGA-28-LAT IGALTVEAQTHAEKASGISGGAGFKGGTDGSLAT 48 9 19%
2896 GVG-26-LVV GVGTKLRLAIDLKRHDTIGIDLVAMCVNDLVV 46 19 41%
2897 LGY-24-ALL LGYMFVALGVGAYSAAVFHLLTHAFFKALL 56 26 46%
2898 VLS-24-VIV VLSGFLGAGKTTLLNHILNNREGLRVAVIV 43 19 44%
2899 AAI-29-IGG AAIDVFPTEPASNSAAFTSPLAELDNVILTPHIGG 56 14 25%
2900 GIE-25-RIL GIELIGVTAGEAKDPEKTIPKAINSVPIRIL 35 28 80%
2901 VLL-25-ASL VLLVENLRFEDLDGKKESKNDPELGKYWASL 67 15 22%
2902 LAA-24-LIE LAAAIGMRSGWQPGTPLLDPMCGSGTLLIE 62 14 23%
2903 LLD-28-AIA LLDEVTSALAAEVEAAIQGSLPGGMRQRSVIAIA 59 12 20%
2904 VLA-27-LTI VLATLLLITIGKLIAALFLVEAFGHFIRTALTI 46 10 22%
2905 AAL-27-SLL AALALVLVLVALAAAILALIAAALFLRGAASLL 97 7 7%
2906 LGG-26-IAG LGGAIGVGLFMGSASTIKWAGPSVILAYAIAG 57 24 42%
2907 GVG-28-AAI GVGATATRGIVGALGLHQVGEATIAKFIQTDAAI 50 20 40%
2908 GGI-26-NAL GGIALHKGDIAEMRTGEGKTLTATLPVYLNAL 37 22 59%
2909 TIA-26-AIT TIAGSDSGGGAGIQADLKTFAALGVYGLSAIT 35 21 60%
2910 LGA-25-LVE LGAGKTTFSRGFLQALGHQGNVKSPTYTLVE 57 19 33%
2911 GIL-29-FLL GILLAEIQQDRLLMAYDTIIIDEAHERSLNIDFLL 47 20 43%
2912 LDV-27-LAL LDVTVQAQILELLLELRQKEGMALLLITHDLAL 54 22 41%
2914 IVA-29-GFL IVAHRDENGAFQSRKELLKVPRLGPKAFEQCAGFL 41 25 61%
2915 ALG-26-ALI ALGILVLGLLVSLFGLLLFTAALAALAGLALI 74 6 8%
2916 ILL-28-LVI ILLLLLAVLGGLLGGGLTTLGSLGALLISAALVI 56 6 11%
2917 LAA-26-EAI LAAQSAVGVSFEQPLLTALVTGLGTAALLEAI 64 15 23%
2918 GLI-25-ASL GLIPLGGALGLCAAGKAVFLIVAAASILASL 53 6 11%
2919 GGG-25-GIE GGGRSSELETAMRVAAGAIAGKYLAEKFGIE 41 9 22%
2920 DAL-24-RLL DALKVVSKGVNALRGEEFGALIITHYQRLL 69 39 57%
2921 GIA-26-VLN GIARALALNPSLIIADEPVSALDVSVQAQVLN 39 22 56%
2922 SGL-25-ELL SGLGTLAASLAAAFVAINAFDLWPLVVEELL 57 21 37%
2923 ALL-24-DLI ALLARIALLVLDEPPLGTDVDGQISLRDLI 52 11 21%
2924 ALE-24-LVE ALELFKPFIFAKLFRRGLASTVKAAKKLVE 57 16 28%
2925 LAA-25-GGG LAADVRPLVRLSVAVIVETDGARERGASGGG 93 17 18%
2926 LGA-27-VGL LGATPALAIGLLAGASIAAGLGPGIASAALVGL 67 5 7%
2927 VLV-26-ILG VLVEIKATGICHTDAYTLSGADPEGVFPAILG 47 15 32%
2928 ILG-26-VLV ILGGPSNPTAGCVELAFFPKVVALAKLYDVLV 52 9 17%
2929 IGA-24-ILL IGAPPGYVGYEEGGYLTEAVRRRPYSVILL 49 22 45%
2930 ADL-24-RLL ADLDYAELRGQIGTGDESMTARTQAAERLL 72 13 18%
2931 ADL-28-GEI ADLALLLAVVSSLRNRPLPQDLVVFGEVGLAGEI 39 25 64%
2932 ILD-24-GIT ILDEPTAGLDPADIQELFELLRSLKQQGIT 36 18 50%
2933 SGV-25-VSG SGVAPQLGLYTAIVAGIVIALTGGSRFSVSG 42 14 33%
2934 DAI-27-GEI DAILDAILAQDPNARVACETTVTTGLVLVAGEI 39 29 74%
2935 VAL-27-IGL VALAGAGLFFGGGGGGPAALLSILALIGGAIGL 68 10 15%
2936 ISA-26-GIA ISALIKKQIENFQPEFDVTEVGQVTYIGDGIA 40 23 57%
2937 LVL-24-LLK LVLWETRVLPVRLLGEKLETDSGTLTPLLK 56 21 38%
2938 LLR-25-LDG LLRIHHVIGELPTYGYRRVWALLRRQAELDG 55 23 42%
2939 GIS-29-LAA GISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAA 57 25 44%
2940 IAD-25-RLL IADHIRALSFAIGDGALPGNEGRGYVLRRLL 55 25 45%
2941 LLL-27-ILV LLLGTPAAGLLGAPGLALTVGLRALGVLLGILV 70 8 11%
2942 LGL-25-AGI LGLATYFTAGEQEVRAWTFKAGIAAPQAAGI 68 19 28%
2943 TLL-24-GLI TLLALDAGTGFIALGLAKAASKAILLSGLI 55 13 24%
2944 VLG-27-DLV VLGALEVDGGGNLANWAIPGKMVKGMGGAMDLV 46 17 37%
2945 LDA-25-ADL LDAVEEALLAGYRALASHPSGETEDSTIADL 57 10 18%
2946 GLL-27-LIG GLLALSGALALAVLFALGTLAAIAGLLGALLIG 75 6 8%
2947 LLV-28-LLF LLVAVLDALALLLAALKVVSVRALAELFLLLLLF 60 1 2%
2948 ALE-29-LLP ALEERRLIDSQRGQRAIGWLIVEDLVMVLLLVLLP 53 13 25%
2949 AGL-25-IGS AGLDVFEQEPLSADSPLLGLANVVAVPHIGS 47 13 28%
2950 LVD-29-VVS LVDVRPVRDTAHLEGKELEFKVIKLDQKRNNVVVS 38 28 74%
2951 LGG-26-GEI LGGAASVQVTDTTDEVVAKLTATPSVTEGGEI 41 29 71%
2952 LPL-24-ALL LPLILELLGALPLSAAAEGLALLAPLLALL 102 11 11%
2953 SGV-25-LDA SGVFYAFGGLLLAGRLGSATNNLGFAYELDA 43 13 30%
2954 GLF-24-AAL GLFLAGQTNGTSGYEEAAGQGLLAGINAAL 65 22 34%
2955 GLI-25-GIG GLIITNCGVMLRAEAFAMKSPPLERAIDGIG 48 10 21%
2956 LIG-26-LGG LIGFDGVGKSIGLSLIAGLRVIRQGQLFGLGG 61 10 16%
2957 LVA-24-GVL LVALGALALLGAVRLAGLALGALLARAGVL 74 2 3%
2958 LLT-26-SLG LLTPSLFVLVFTLPLDGGLLLARIVGGLASLG 51 4 8%
2959 ALV-25-LLK ALVMNPTRVLPDELTGALDVTVGAQELLLLK 56 26 46%
2960 LAI-25-IAA LAIFTGQKAAALAAGNRVLAKPAETTPLIAA 63 14 22%
2961 LVS-26-IEA LVSVTERTREIGIRMAVGARRSDILQQFLIEA 39 25 64%
2962 SGL-25-IGG SGLITPSLDEMVHVAKEMERQGFDIPLLIGG 47 28 60%
2963 GVI-24-ATL GVIKDSLALELLPYGYFFAPELSTSNLATL 42 8 19%
2964 ADL-26-ILA ADLMMVASKEVEDAIARLAQKARAAGIHLILA 48 23 48%
2966 LLT-24-LDL LLTKALRPLPDKFHGLQDQEQRYRQRYLDL 53 26 49%
2967 GLS-25-IGV GLSGRPLQEKSTEVIRRLRLELGGRIPIIGV 44 28 64%
2968 RLL-27-VLE RLLLARLGMPNCPFLALPEPAQTLDQDVDEVLE 51 23 45%
2969 GIG-28-VIV GIGGVLEPLQAAPTIIEDNCFIGARSEVVEGVIV 40 15 38%
2970 TGL-25-AFL TGLFLGIAGVIQMAGPAVILGYAIAGIIAFL 42 18 43%
2971 LLV-27-VLL LLVGLAARLTVVGALDQSLFLLLGARPLALVLL 86 10 12%
2972 GLG-24-ALN GLGQDEWGKKALADVENATKPQGDDADALN 45 9 20%
2973 AGL-26-IAV AGLEVKRIINEPTAAALAYGLDKGGGNRTIAV 67 24 36%
2974 RLL-25-GIS RLLDIVDKLTPMLEAFAEADNVLRQGVQGIS 41 16 39%
2976 GGG-29-SLA GGGNIFRGAALAGKGMDRATADYMGMLATVMNSLA 49 14 29%
2977 DVL-29-VVS DVLLLDEPTNGLDIQAISWLEDFLINFENTVIVVS 38 22 58%
2978 AIV-26-GLV AIVWQCRRTAPICEQLKRDGLEDYIREATGLV 52 29 56%
2979 IGA-27-GAS IGAYQGEANGKKITFLDTPGHAAFTSGRARGAS 46 11 24%
2980 LGS-24-VAL LGSGVIMSQDGYILTNKHVIDDADQIVVAL 56 21 38%
2981 LAA-24-SLV LAAAFSVAEGLLALASAMGAFSRPALASLV 70 1 1%
2982 LVG-29-VAI LVGGQTRMPAVQEKVKEFFGKEPRKDVNPDEAVAI 57 30 53%
2983 VID-24-DVL VIDVYPYGGEVANHETGEILATFETKTDVL 39 11 28%
2985 LIG-29-IAA LIGIGIGAGGIAATSIFTELISLTQRAFSLSGIAA 58 10 17%
2986 VLA-24-AIS VLACFVGYYVVWNVTHALHTPLMSLTNAIS 60 20 33%
2987 ALK-28-AEI ALKNIIAVGAGALHGLGYGDNAKAALITRGLAEI 43 21 49%
2988 GVG-24-GVS GVGDVVGFGSRLPTGVAGLRGVLAAAHGVS 46 7 15%
2989 LGS-25-ALI LGSLGFHGAKLLELLAAFSGGIKAPLVLALI 48 6 13%
2990 IAG-24-VIG IAGAAVAAIATSFGKDLAQAGGIDPTMVIG 54 4 7%
2991 DVL-26-LPL DVLFRRFGGRADLKLIEVLTPAREEGTKLLPL 53 11 21%
2992 DLV-24-IEL DLVRWRPDGVLEYLGRIDHQVKIRGFRIEL 38 22 58%
2993 DIL-29-KLA DILNRIAKELAILVEIYEGDFETITEVDSKLAKLA 38 10 26%
2994 GVS-29-DLL GVSCVKLRGALYAFPRIDLKVYLIGDDEEFVLDLL 42 13 31%
2995 SLL-25-GAL SLLIVSAILFESFLLAKGTFAAGPLFSLGAL 74 6 8%
2996 SLA-27-IAA SLAFLINAASPLGAILPVSAVSATAILAAGIAA 67 6 9%
2997 VLV-28-AAI VLVTDMTDPDWEPIMKRASAIVTNRGGRTCHAAI 62 29 47%
2998 IAL-26-GIG IALAMIEKAEAEGLLKPGDTIVEPTSGNTGIG 54 22 41%
2999 AAI-27-GGI AAIIAAVLIGAYVIVFDLDYLAVVLAIALPGGI 48 7 15%
3000 GSL-29-VAL GSLALDIALGAGGYPKGRIIEIYGPESSGKTTVAL 54 15 28%
3001 GID-29-VVL GIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVL 39 22 56%
3002 LAE-26-LIE LAEKALELQGIVALLRADIPLIIGASPKTLIE 51 6 12%
3003 GLV-27-GIV GLVEQLLLGLLIELAGKLSKVIITARDLLAGIV 54 8 15%
3004 GLV-27-GIT GLVAFAAATGVMPLDMPESVLVRFKGKMQPGIT 41 19 46%
3005 ALE-28-DVL ALEKLLQEELFDLLLPELEALQQIAYALAELDVL 50 13 26%
3006 LDL-24-LDG LDLWFGDINDLLIQLDDGLNAKVDAWFLDG 45 12 27%
3007 RLL-29-LVG RLLAFAGRGPPLGLRLKALSEGLKAGGGRVSELVG 58 7 12%
3008 LAT-28-ILA LATQTLLPIVAAFMAVAGIGVLTRDISLKDRILA 52 21 40%
3009 VLL-25-LVL VLLALLAGVLALYPALEGYKLAGRAAAGLVL 90 8 9%
3010 GLL-26-ILL GLLTDGVVKLPHCVLLLDEIEKAHPDIFNILL 76 16 21%
3011 VLA-26-ILL VLAATLYGALGALLAGLLAALAVGLLASVILL 63 6 10%
3012 VLA-26-LGT VLAAALAAGGSLEEGCTLANAAAGVGVGLLGT 56 11 20%
3013 AGL-24-LIA AGLDPTAVNGGLVKAAGVHAALGSGRYLIA 81 13 16%
3014 LAA-26-GDL LAAATSYSGNLTPMIAQYTRLSMFGFQRIGDL 70 11 16%
3015 LLF-25-EVL LLFDDIPFLEDAQKEHDAFAQTLRDEGVEVL 40 23 57%
3016 ASG-26-LDA ASGKGGVGKSTTAANLALALAAGGLIVGALDA 53 25 47%
3017 VIE-26-LVS VIEALGAGNLPPDALGDLERLGGLGIPVVLVS 41 16 39%
3018 GLF-24-VVL GLFVGSGHAIAAAGPAVLLALAAAGGLVVL 45 9 20%
3019 ALI-26-AIG ALIGIQNPKGLTAIKTADSDALRVGDYTIAIG 55 9 16%
3020 LSG-28-IAT LSGGVDSNALHIPKRFFGAARNIEEGGSLTIIAT 45 14 31%
3021 VLA-28-GVS VLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVS 52 20 38%
3022 GAL-26-LGF GALEIGLHELGDSTYLLDGDNVRHGLGADLGF 50 15 30%
3023 LLP-28-LAS LLPLLVALALPVAPLAVLLVLRALTAGLPGLLAS 57 8 14%
3024 GLD-29-GEL GLDIMALANTEMPLRAYLGLFNFAGLDQSKRLGEL 44 6 14%
3025 LVL-24-TLA LVLLLALLSLESRGTVALALLTGAGKSTLA 67 6 9%
3027 VLV-27-LTI VLVTGPTGSGKSTTLAAMILYENATVIAHILTI 40 11 28%
3028 LEL-25-LGS LELKEVPKKLLVMGGGIIGLEMGTVYHALGS 42 18 43%
3029 GGI-27-SIA GGICHNEEELLEIVSNGLKLSPVTQCLLEKSIA 41 18 44%
3030 FLA-24-VIE FLANGQAAKGLIEIIEQAGAKVAGIGIVIE 33 24 73%
3031 NLA-26-LEA NLAAQSHVGVSFDQPEYTAEADGIGALRLLEA 39 19 49%
3032 VLE-25-FLL VLEELSTTMLMGFCLDDLAPSLGAADENFLL 37 6 16%
3033 IAG-28-GLG IAGGHTGGKTHGAGLASGVGPDPEAAVIELQGLG 62 17 27%
3034 TLG-29-LIE TLGGTGGGIAYNEEELREITENGLKLSPVTQCLIE 38 24 63%
3035 AVL-24-GVG AVLLGLGLAGLACAIMGGPVAKAAGAGGVG 56 8 14%
3036 GIA-26-LEA GIAAAQASEKVLALSSVEENGVGEKVADLLEA 50 6 12%
3037 LAL-28-DVI LALDNDLEILPVINKIDLPAADPERVRVEIEDVI 46 18 39%
3038 VLL-26-SLL VLLALVLSALGLLAALRLTLDFLGAVLVISLL 81 6 7%
3039 LLD-28-GVV LLDEGSFLELDAFARHRSTDFGLGATKAAGDGVV 51 18 35%
3040 LAK-29-DLV LAKLAAAPFVKVEATKFTEVGYVGRDVESIIRDLV 47 13 28%
3041 AGI-24-VIL AGIESVPKGQAEAALALGLRPTNAMIVVIL 57 22 39%
3042 VLI-28-GIV VLIIDDFLANGQAAEGLILIIIQAGAKVAGIGIV 43 18 42%
3043 LAA-29-GVV LAAGNTVVLKPAALTPLSVLLLAEIAGDLLPAGVV 85 15 18%
3044 GLA-28-ELL GLAARGDRIAGPLSGIDKQELGDARLLRIAPELL 60 15 25%
3046 LVS-27-LVV LVSELILGVLPLAVNFPRRNRIISGLSLGVLVV 54 11 20%
3047 DAL-24-AGI DALTLAGVAALLRSLLAAVLGVATASAAGI 51 6 12%
3048 SLV-25-GLS SLVIANLPGYLAIGLMALALLLSALLFLGLS 47 8 17%
3049 VFL-26-LLA VFLCLAALYESWSIPFSVMLVVPLGVIGALLA 56 30 54%
3050 LLL-27-LLF LLLASLFLGLLLALKLGLIFILLLLLALGLLLF 97 6 6%
3051 IAL-24-LVL IALILGAAGGKPSHGANDGQDAIGLSMLVL 72 15 21%
3052 VAL-27-GIS VALTNGAQQADTGTKMIHIGKNTRSTIISKGIS 44 15 34%
3053 IGL-27-LLS IGLPWTGLAMAAITEKAVLVLALILLGELVLLS 67 15 22%
3054 IAA-29-EAL IAATTSGLSAGGGGVMALALAIADVEEERRAAEAL 76 1 1%
3055 LPL-27-GKL LPLPKHLDAAAILEAIDPEKDVDGLHPANIGKL 40 15 38%
3056 NAL-27-LAI NALSPAEVLKVILDEESESTTVVVPDYQLSLAI 42 20 48%
3057 ILA-25-TLA ILALNAAVEAARAGEQGRGFAVVASEVRTLA 56 34 61%
3058 EIA-25-LGL EIAKNAILAYVYTLAGNLVAVVSDGTAILGL 50 12 24%
3059 AIG-24-AGI AIGGIGKGHLVKEIDALGGLMALAADAAGI 55 25 45%
3060 IEL-26-GIA IELCCQRGIPLVFLQNITGFMVGRKYEAGGIA 36 22 61%
3061 GDL-28-VAL GDLFVPAADGVLTSAAPRPTADAELAAAAALVAL 43 8 19%
3063 LLS-28-LGV LLSALTIILAALAALRADRSDVLLLALLAAALGV 69 2 3%
3064 IAL-27-LLA IALVALLAAKELGIKAVAVASTADLALALLLLA 103 14 14%
3065 AAL-28-TLG AALLGGVAAAAAAAALGALDGILRLAGLAIVTLG 77 2 3%
3066 LGL-28-DLL LGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLL 65 19 29%
3067 LLS-28-VIA LLSVLLLAILIVALLGLVTIFILGIALAGGIVIA 60 6 10%
3068 LLD-27-LLD LLDRKPKALSGGQRQRVAIGRALLSEPELLLLD 72 37 51%
3070 LGA-29-IGG LGATVQVIPHITDEIKRRIIEGGEGYDVVLVEIGG 57 26 46%
3071 LEA-29-SGI LEASVRYLAAALGPEGIRVNAISAGPIRTLAASGI 38 21 55%
3072 GGS-27-LSV GGSGTRLYPITRGVSKQLLPIYDKPMIYYPLSV 41 19 46%
3073 LGI-27-VSV LGIITDDPLGLTAAFGDADSQADVVISSGGVSV 42 11 26%
3074 ILL-25-IVA ILLLLLVLGLLKHLGIVIIVLTIALLTLIVA 53 9 17%
3075 SGL-25-LTL SGLMVGLGETNEEIIEVMRDLRRHGVTMLTL 55 19 35%
3076 LLP-24-LVA LLPDTVGTGGDSHTRFPIGISFPAGSGLVA 64 24 38%
3077 LAT-25-ALG LATLIAVRGLLEVALDGKAGVGLLELAIALG 68 7 10%
3078 ALL-28-YLL ALLLLALGAAGGLLGARGLSALRLALLLGAAYLL 62 3 5%
3079 ALG-25-LLT ALGVDLQAIEPAVLGGALLAQSGGPIAPLLT 72 18 25%
3080 ALG-25-ISG ALGAALGIARGNSIIAGMDGALTLRAGDISG 47 9 19%
3081 DLL-29-DLL DLLAEYAGRPTALTKVQNLAAELRTLLYLKREDLL 57 11 19%
3082 GLV-24-LGI GLVRGGAGTALVGDGPTVAARIIEYAALGI 61 17 28%
3083 VEL-28-GAG VELPLALPVIMAGIRTASVLIIGTATLAALIGAG 43 28 65%
3084 AIL-29-AVL AILKAVLLHSTLIIALYNLAAAIEKGALAILAAVL 64 10 16%
3086 RLL-27-GLG RLLAKQIDQPLHLGITEAGGARAGAVKSAVGLG 57 15 26%
3087 LPL-28-TLL LPLAFAAEDGAELAGPLAFLALLGALLTTGGTLL 65 14 22%
3088 GSG-27-LGF GSGFDLPDKACPKCGTPYKKDGQDIPFETFLGF 42 21 50%
3089 VSV-26-EIV VSVGATTTIMLAATLAEGTTILENAAREPEIV 34 14 41%
3090 AGL-29-IAA AGLGGGHDEREQTLNQLLVEMDGFEGNEGIIVIAA 97 41 42%
3091 LSA-25-LDA LSAFVLFLSAAGAEGLAGQVNYAAANALLDA 62 11 18%
3092 ALV-29-IGL ALVATGSPFAPVLIKIKGAPIAQANNGFIFPGIGL 61 13 21%
3093 LAE-26-LAE LAELIRLLAPGPVVAVNAVEAAMAAAARDLAE 90 7 8%
3094 LPL-29-LTL LPLLLVGGEAGRLGGEFALTASTAPDALLAVSLTL 60 18 30%
3095 DVL-27-VLI DVLDGGIGSNRLEGGAANDVLRLGYQSADNVLI 39 12 31%
3096 GIS-24-TGL GISEEDQKRLFERFYQADKSRSRRYGGTGL 38 26 68%
3097 VVI-26-VSV VVIAGHKDAVERAGAACKAAGAKRALPLPVSV 37 17 46%
3098 VLA-29-VSV VLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSV 56 20 36%
3099 LLA-26-LTL LLAGGGVALGALILALGLAAAGSAPRGRALTL 91 6 7%
3100 VLA-24-LLP VLAGFMRILSPAFVAHYAGRLLNIHPSLLP 67 25 37%
3101 LVV-25-SVV LVVMVGDLKDLPVVAAAFEFAFIGGSMGSVV 42 10 24%
3102 LSV-25-VAI LSVAFDLATHRGYDSDHPRALGDVGKAGVAI 42 24 57%
3103 GIA-26-IAG GIAGVPGVSFVVLLATLGSVGIPLEGLAFIAG 52 15 29%
3104 SGG-29-GVV SGGSAAAVAAGEVPLSLGSDTGGSIRQPAAFCGVV 49 33 67%
3105 ITL-27-LTG ITLPLLKTAIILALVLSVINAFRNFDAIFALTG 41 9 22%
3106 VGI-29-IAG VGIVEVPDERLAKLAEIVNPKKTIPTTFEFVDIAG 44 25 57%
3107 IGS-28-VVL IGSGPIIIGQAAEFDYSGTQACLSLKEEGYEVVL 40 22 55%
3108 LLL-25-VLF LLLDEPTNHLDIETIAWLTEFLKGSKGTVLF 64 23 36%
3109 ALG-27-VVI ALGQRGVNIMEFCKAFNAKTQSIEKGLPIPVVI 51 23 45%
3110 LID-27-LAT LIDEVHMLSRHSFNALLKTLEEPPEHVKFLLAT 48 25 52%
3111 IVV-24-ITL IVVAPGVVVKLKDVFILALAAGLNFAGITL 36 8 22%
3112 LLG-27-GLG LLGGLPGVLLGKLTIIGGGVAGTFAAKGALGLG 89 14 16%
3113 LLD-28-VGI LLDEALARADGLVAEKNPDMPAAELEKLAAAVGI 42 11 26%
3114 VGL-24-LAA VGLAGAAAAYPLQLSGGMAQRVAIARALAA 93 27 29%
3115 EIA-25-LGA EIALPTKPLATVDDENGEIALCTLSAFNLGA 47 12 26%
3116 IAS-29-ELL IASDCADGMTKLIFDKEDHRVIGGAIVGTNGGELL 47 13 28%
3117 ADL-25-TLL ADLGDVVPATADIFATNAGGLAVKALTFTLL 54 16 30%
3118 LEV-25-LVF LEVERIVNEPTAAALAYGLDKTDKDEKILVF 31 19 61%
3119 ALN-29-LEV ALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEV 35 25 71%
3120 LLI-24-LSV LLIPLVFTVAKEAGVSLLALGLPALAALSV 52 14 27%
3121 ILA-25-VAI ILAAAPAVGKTAFVLNIAQNVGTKADLAVAI 51 12 24%
3122 AIG-29-GVV AIGAGLPVSEATGSMVVDIGGGTTEVAVISLNGVV 52 20 38%
3123 SAI-24-LAL SAILGMHAIKDRPMAVNGQVVILPMMYLAL 55 21 38%
3124 LLV-27-SLV LLVVALAALFGVALGALDDGAVFTELALAGSLV 59 4 7%
3125 VLV-24-SIA VLVDPGVDEAIASMMDVSLVSPLLMAWSIA 41 7 17%
3126 LGG-26-NLL LGGAMIAMFGMVAADGLDMLIKVDFRKQFNLL 44 15 34%
3127 VSL-29-LAA VSLDNLADELKAGEIIAVNVAIVADVQGSVEALAA 73 13 18%
3128 VLE-28-GLA VLENIEEAPVIVKGESAEAAKANALELLAKVGLA 50 19 38%
3129 DVL-25-LVL DVLALLESLTLVDVDALSDVDVLVESEGLVL 52 19 37%
3130 DLV-28-LTG DLVAGAKRVIVIMEHVTKDGAPKILEECTLPLTG 42 23 55%
3131 IAD-29-GLG IADVLDMTVEEALEFFENIPAIRRKLQTLVDVGLG 43 29 67%
3132 ITA-24-LVV ITADQTSVAENVKPTFTVHVNQPLAHDLVV 42 27 64%
3133 LDG-27-LAA LDGGRFATSDLNDLYRRVINRNNRLKALLDLAA 80 15 19%
3134 LLT-25-GLI LLTSRAEYRLLLRADNADLRLTERGAEIGLI 53 11 21%
3135 VIG-24-IGA VIGSVPPHDLVGIIPLKVIEGDVMFIDIGA 57 16 28%
3136 GLD-29-EVL GLDSGQEGVIAVYDLGGGTFDISILRLSRGVFEVL 42 21 50%
3137 SIA-29-LAE SIAVGIAAALIAPGAELADTLLGEELEEAAKELAE 44 6 14%
3138 ALA-24-EGL ALALRDEVADLEAAGIKIIQIDEPALREGL 72 32 44%
3139 AAL-29-IAG AALVGLALVALALESPAAAAIRGSAKATLLLLIAG 85 8 9%
3140 AGL-24-GIV AGLAAAFTGPMPTPAVAYLTRTFRAEAGIV 58 12 21%
3141 GLL-26-GEL GLLLDPYFSGTKVKWILDNVDGARERAEAGEL 56 16 29%
3143 LGV-27-VVL LGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVL 60 36 60%
3144 AVL-28-IGA AVLPTMGGQTALNLALELARLGVLELFGVTIIGA 60 14 23%
3145 GVL-26-IAV GVLAAASCEGKVFTGAILGLLRQGAEAVAIAV 47 6 13%
3146 LEA-25-VVL LEARALMMSTNNILSPANGEPIIVPSQDVVL 49 23 47%
3147 LDG-29-AIL LDGATALASGESKWITSPLARLDVEITRALSMAIL 46 23 50%
3149 GSG-27-SVL GSGTRLYPITRGVSKQLLPIYDKPMIYYPLSVL 41 22 54%
3150 VLT-24-ALA VLTLQAREQHIRRDKATSNICSNQALAALA 79 12 15%
3151 ASG-25-ASG ASGAFSTAVGAGAYASGAGSTALGGASGASG 58 20 34%
3152 AAL-27-SLG AALATATVIPLALLATLTGGVLGGVSALLASLG 84 9 11%
3153 GLS-25-GLG GLSPELVLGYFGAGAIGGATPAALKGGAGLG 62 7 11%
3154 LVG-25-GLL LVGLLLGLGSAGLGGASALSAAAGGIVLGLL 80 7 9%
3155 IAG-26-LLG IAGFLAAFILGFLTGSLAIELMFSLLGLALLG 70 11 16%
3156 LGI-29-GAS LGIEGTALGDDVLEAEMPVDARTHQPFGLLHGGAS 46 15 33%
3157 VLE-29-LGV VLEAIVRDIPAPEGDPDAPLQALIIDSWFDNYLGV 49 23 47%
3158 VIV-24-VLG VIVTTPQDVALLDAAKALDMFRKVNVPVLG 45 16 36%
3159 VVS-26-ALV VVSMLNSYSGWAAAAAGFMLSNDLLIVTGALV 49 23 47%
3160 GLF-29-VLL GLFIAFMGLKNAGIIVANPSTLVMLGNLTSHSVLL 51 20 39%
3161 LGL-29-SGG LGLPKAEALARAEEALERVGLADLADRRPLTLSGG 69 31 45%
3162 ILA-25-DAI ILAAAGISEDGRVALLTVDQEDAIRRVADAI 42 8 19%
3163 TLA-26-IEA TLAAAIVMLSGWKPDTPLLDPMCGSGTILIEA 47 24 51%
3164 IVD-27-GLG IVDHYTYVFMGDGCLMEGISHEACSLAGTLGLG 36 26 72%
3165 LTG-25-AVL LTGLPNRRLLLLGLEAGADLAVASGRIGAVL 67 7 10%
3166 ELA-26-DLA ELATPVNNGETVTLSYTDPTAGDDLNAIQDLA 61 15 25%
3167 IAG-25-GSI IAGNIATAEAARALIEAGADVVKVGIGPGSI 39 28 72%
3168 GVV-29-LLR GVVLGGDEGLAFELAVGANLIGAELSAFDSYLLLR 48 10 21%
3169 LGF-25-LVE LGFGVEGLELKFTVSVPSYRWDISIEADLVE 36 14 39%
3170 YLL-29-LGI YLLIGFWFKKPSAAFAAMKAFIVNRVGDFGFLLGI 48 21 44%
3171 LLS-28-LLG LLSLGLADLALGEYGALLIIQADLLPGGLYTLLG 92 7 8%
3172 SLL-27-GSL SLLVVNDDELVKVHVHTEDPGLVMDLGLKYGSL 58 14 24%
3173 LVE-24-LVG LVERTKTPVRQALKDAGLSLSDIDEVILVG 46 24 52%
3174 GAG-24-GSL GAGPGDPELITVKGRRLLEHAPVVIYAGSL 53 27 51%
3175 FLA-27-SLL FLAMLALTLFLRYSLGKRALRLCAEDLKVASLL 51 7 14%
3176 EVI-29-ILD EVITLIRSSETADIAQAELMERFDLSERQAQAILD 37 23 62%
3177 VLF-27-LLD VLFALDLAIGLAGTLLSATNGGTLYRAASFLLD 38 12 32%
3178 EAL-28-VEL EALGLSLPGNGSLLATHADRKQLFLRAGKRIVEL 49 23 47%
3179 GLI-27-LLV GLIAMLVITNAYGLVASSFFGAKFQRNIELLLV 62 12 19%
3180 VIL-26-SLL VILGQVPYHGAGAAHKLFFLVVPGLLVLPSLL 60 12 20%
3181 GGI-26-AIT GGIYNFVTKRGLCRGENSKISWTQVETGSAIT 35 28 80%
3182 AIG-28-LLL AIGIAGMDRLLGANVIATSGRAVEAAGDVDVLLL 82 20 24%
3183 LGL-26-LIA LGLLLSDLEGALKALSVLTDLALRGVLDILIA 83 14 17%
3184 ELA-24-IAG ELAASIAEHGVIQPIVVRPAEDDRYEIIAG 51 21 41%
3185 LEA-25-ALG LEAGFLGVMLFGWNRVGAVLHFFATAMVALG 59 15 25%
3187 GSG-26-EAI GSGPIRIGQGVEFDYATVHSVKAIQEAGYEAI 38 26 68%
3188 GGS-27-VAI GGSTRVPLVRERVGEFFGKTPLTSINPDEVVAI 38 24 63%
3189 VFL-28-LSA VFLLWGSHAQKKGALIDRQKHRVLKAPHPSPLSA 40 20 50%
3190 ELL-24-EIA ELLEKVGLAESPDRLVTDLSGGEQRRLEIA 50 17 34%
3191 LGI-29-LDG LGINPLEHDIRFVEDNWENPSLGAAGLGWEVWLDG 46 23 50%
3192 LVG-29-IGS LVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGS 42 26 62%
3193 LAS-28-GLG LASISGLADIVLCFVAAAVIALVWQGELQGAGLG 61 9 15%
3194 LDA-29-DVI LDALKYGTPPHAGIAFGLDRLVMLLTGTDSIRDVI 40 25 63%
3195 VLL-24-IGL VLLGTFAVLAAFGFSINTLTMFAMVLAIGL 72 26 36%
3196 LFG-26-GSG LFGYTSMVYATAVITILSFGVWLHHFFTMGSG 40 17 43%
3197 ALG-29-VIL ALGGALGAIAILLRQELLLVIMGGVFVVETLSVIL 53 23 43%
3198 SLA-26-LAK SLAGRDKAFGATLDITQEAVSSLLRFAPILAK 54 6 11%
3199 IGG-24-LAT IGGGNLFRGAGLAAAGMDRVTGDHMGMLAT 45 29 64%
3200 GKL-27-LTG GKLHIGHAYTTIACDVLARYKRSMGLTVFYLTG 43 15 35%
3201 GID-28-ALV GIDPWAFVYPKRFLGAAKNIAEGGSLLFEAGALV 43 19 44%
3202 VLT-26-ALL VLTLLDSLVLGGAVLLAMLAIISWLLTLIALL 66 9 14%
3203 AIA-26-VLE AIARALAMEPAVILFDEPTSALDPEMVKEVLE 52 21 40%
3204 ELL-27-ELA ELLQLAGERLTVPLVAAGPGLGRLTSELAGELA 77 10 13%
3205 LSG-25-LIG LSGLITPSLDEMVHVAKEMERQGFTIPLLIG 56 22 39%
3206 LVG-24-LGA LVGGIGVMNIMLVSVTERTREIGLRKALGA 78 19 24%
3207 AGI-25-ALA AGIAAAVVPTGAALGLGGVGVGLARALKALA 96 6 6%
3208 AGI-25-LGF AGIAAFDTVYSDANNEEGFLQEVAHIKQLGF 42 18 43%
3209 DVL-26-GLL DVLPSSVARAAGSEAAAVILTGRESDGVPGLL 51 9 18%
3210 IAS-24-LAA IASLAAVYHGALLDKRIAGRIHTVLALLAA 66 10 15%
3211 ATL-26-LTL ATLIPAIAVPVSLIGTFAALYLLGFSINGLTL 55 17 31%
3212 AEI-28-VLG AEIRMAATLGADAVGMSTVPEVIVAPHAGAKVLG 39 17 44%
3213 LIG-25-VLF LIGAPPGYVGYEEGGQLTEAVRRRPYSVVLF 44 20 45%
3214 IGL-29-ELI IGLMPHMTIKENIKLVPKLLKWSKEKKKAKAKELI 40 10 25%
3215 IVL-24-GIG IVLNPLGVPSRMNIGQILETHLGMAAKGIG 45 17 38%
3216 IVS-28-LGF IVSSLGGIEMAELVRGLIFASDKGQAEAAAALGF 37 6 16%
3217 ALL-29-LIV ALLATTLRGLSNDVYFQVGLLTTIGLSAKNAILIV 67 31 46%
3218 LGI-28-VAL LGISTWYFGEIQEDWAAVFPTLELLFGLGKAVAL 65 13 20%
3219 IAA-29-GLV IAAAGANGGGALFLIMLALGAAIAAGLAAEVAGLV 65 9 14%
3220 ALI-27-GDL ALITRGLAEMSRLGAALGADPATFMGMAGLGDL 41 24 59%
3221 VLV-25-VLS VLVPTTLLAQQHFENFKARFANYPILVEVLS 52 15 29%
3222 GSL-26-VIE GSLALGGAIAGISILLKQEILLIIIGGIFVIE 33 19 58%
3223 GVV-27-LAT GVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLAT 47 17 36%
3224 GAI-28-AIV GAIAGIGLDLLATDLGAVLATLLLIVYAVLGAIV 49 12 24%
3225 AIE-27-GFL AIEAADLTKRFGDFTAVDHVNFRIPRGEIFGFL 34 22 65%
3226 GIS-28-GIG GISDLIAVPGLINLDFADVKTIMSNKGSALMGIG 41 21 51%
3227 GLD-29-EIL GLDVGAIEYIHKRLIEERDKGKAVLLVSLELDEIL 38 22 58%
3228 GLD-29-LLN GLDIDALKVVSKGVNEMRGEGFGALIITHYQRLLN 41 25 61%
3229 GGS-27-IGG GGSMIMLAKGNRSQQVTDACAKHGGFYLGSIGG 45 20 44%
3230 ALN-26-GGG ALNQKGKATMIALREPSLGPVMGIKGGHAGGG 41 13 32%
3231 GLL-25-GGI GLLATADGLIDTDVFIVGFGVGALILLAGGI 55 9 16%
3232 VLG-26-SLV VLGPALLRRRTTQEFIAIVQQSFEAGMTVSLV 51 13 25%
3233 LVS-24-LVA LVSGTDGVGTKLRLALDLKRHDTIGIDLVA 54 26 48%
3234 LIV-27-AVL LIVDQPTRGLDVGAIAYIHKRLISERDVGKAVL 57 21 37%
3235 VLL-29-ALG VLLALLLAAAPAFLSLLALSLILGLGSLAILLALG 85 8 9%
3236 EAL-24-LIA EALEAVADETAALIITGEGDVVQPELDLIA 63 11 17%
3237 AVL-24-ATL AVLATLAHGVHGKGARTAGLAIEDQLFATL 70 5 7%
3238 LVA-28-LLT LVASATEGGMRLISVGSGGKGNKIRRAESYKLLT 66 23 35%
3239 EVL-24-IAT EVLDPEQNNTFFDHYLEVDYDLSKVLFIAT 37 16 43%
3240 LPL-24-LLL LPLLVLSLAVASLLSLDAATGLVLGLSLLL 90 12 13%
3241 GSL-24-GIE GSLGAMSKGSSDRYFQSDNAADKLVPEGIE 35 23 66%
3242 VAI-26-DVL VAIARALAMNPDVMLFDEPTSALDPELVGDVL 40 31 78%
3243 VAI-26-GIE VAIGAAIQGGVLTGDVKDVLLLDVTPLSLGIE 35 29 83%
3244 GID-25-GGI GIDVFDIEVDELDPDKFIETVAALEPTFGGI 35 22 63%
3245 VLL-28-RIL VLLYYKYTTIEDPEVFAAEHLAFCKSIGLKGRIL 45 19 42%
3246 ALA-24-LFG ALAYAKGIGATRAGVLETTFKEETETDLFG 70 18 26%
3247 LSG-28-DAI LSGGQQQRVAIARALAIRPKILLLDEPTSALDAI 41 23 56%
3248 AGL-24-LLR AGLAAAAQGGTLGLDVIGFERLERQGGLLR 72 21 29%
3249 LAE-29-IAV LAEKLPDKAVFAGDRPDTWLAARENGDLIAYPIAV 48 12 25%
3250 GLI-24-VVS GLILAFFVIGDLLAALLGSKTAVIIELVVS 42 10 24%
3251 IGG-26-GLV IGGLLIGMFQHDMSFSDAASTYTLLTIGDGLV 54 24 44%
3252 GIS-28-LAI GISEEALPRIFERFYRADSARSRRTGGTGLGLAI 43 25 58%
3253 GLF-28-ELL GLFPHLTVAENISLVPKLLGWPKLKIAARVQELL 39 17 44%
3254 LLA-29-LVV LLAGALLALPLRTAAALLLLLGLLALLVLGLGLVV 87 9 10%
3255 SLL-25-GVL SLLTLLDDIATLLDDVVLMLKLALKLIAGVL 68 11 16%
3256 VSL-24-IGV VSLRGAVSIARRLQDPLAELVKIDPKSIGV 43 30 70%
3257 LDV-24-LLG LDVTADTATLGKTPGKDAQAGKSTYPALLG 49 22 45%
3258 LDI-29-IAT LDIETLRALENALLEFPGCAMVISHDRWFLDRIAT 32 16 50%
3259 LGI-28-LLG LGIALELISPVLFDVAFLLLGQTLITTFASELLG 79 13 16%
3260 GLV-26-LLL GLVLPHLARLLVGALHRLLLPAAALAGAALLL 89 16 18%
3261 LEA-24-GIL LEAMAIGMPKVTGLLVGGIGEVIENDDGIL 38 8 21%
3262 LID-29-GIE LIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIE 35 27 77%
3263 GEL-29-AAL GELATAEAALLSAKQALALTGTLGSALLATQVAAL 77 14 18%
3264 GIS-29-AIV GISEEDLPRIFERFYRVDKVRSRATGGTGLGLAIV 40 14 35%
3265 SLL-27-LGL SLLLGFGGAALASGLAASAAFLLLLKLGLALGL 90 12 13%
3266 DLL-27-VAL DLLVNVVDASNLLGNLLLLLQLLELGIACIVAL 52 7 13%
3267 LAE-25-VAL LAERVGLATLPCWKRVKQLEDGGVIVASVAL 64 14 22%
3268 GSG-29-GLG GSGGVMLPNHSPLVIAEQFGTLETLYPGRIDLGLG 58 30 52%
3269 GIV-24-LTG GIVSAVMVALEQCPPELASDISERGMVLTG 44 19 43%
3270 GAI-25-EIL GAIEYIHKRLGEERDTGKAVLLVSDELDEIL 40 18 45%
3271 VAL-24-TLA VALVAGDAMGHGLVAAARMGLLRLLARTLA 70 11 16%
3272 LLT-29-LGG LLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALGG 59 28 47%
3273 GLG-26-GLF GLGRLAACFMDSMATLGIPGHGYGLRYHYGLF 45 33 73%
3274 VIE-29-GAG VIEEAPAPGLDEALRAAVGAAAVSAAIAIGYVGAG 43 20 47%
3275 GIE-29-LLL GIENLLRSLPEFLSGGRKQRVAIELALVTLPYLLL 45 22 49%
3276 VLF-24-IAL VLFVSSRRNGRSLGELVKEEMGLVPGTIAL 42 17 40%
3277 LLS-26-LGL LLSRALQLLRLSFLGGLLAAFALIILVLLLGL 89 2 2%
3278 AIA-28-GFL AIAGDYMSAASFLGISALVATSGYDGLIYSLGFL 48 19 40%
3279 DLL-24-LVD DLLLDPIIIFRAASDILKAEHRDFLYILVD 44 6 14%
3280 DLL-25-ASG DLLDKLNPGDLLVFNATRLIPARLAGIKASG 49 10 20%
3281 LLT-24-LGY LLTSMTDAMRFPGGEMADLYSHRWEIELGY 38 17 45%
3282 LLK-29-SLG LLKPASEGTGVAAGGAVRAVLELAGVADILSKSLG 47 23 49%
3283 LGG-24-LTL LGGLLGARGGWAYVTLANAPVGLDALILTL 54 5 9%
3284 DLA-29-LLL DLARALRELPILVMLFGLKNLLAPLLLPGSKRLLL 59 8 14%
3285 NLA-28-EIL NLARMRKQDIIFAILKQHAKSGEDIFGDGVLEIL 38 16 42%
3286 ALS-27-GLD ALSGGNQQRLIIARELARDPDLLILDEPTTGLD 47 26 55%
3287 VLV-27-LIE VLVCVPAGATQVERRAIEESAQGAGAREVFLIE 43 15 35%
3288 GAL-25-GEI GALKALAASLMKIANDVRWLASGPRCGIGEI 41 16 39%
3289 GSG-28-GEL GSGKTISLAGPSIIFVYMIIGFMLFFVMRAMGEL 43 20 47%
3290 GLA-26-SLG GLAWTEVGGDLLTIETACVPGKGKLTYTGSLG 59 27 46%
3292 LLI-27-IAL LLIAGLALLVGALPLLLTLLVAILGMIAALIAL 67 6 9%
3293 LAS-26-LLL LASLAIAAAALVAAALIGLLFLVAILGATLLL 91 2 2%
3294 GLS-25-LEA GLSGAFIPVSEDEGMIAAVQAGALVLEKLEA 48 18 38%
3295 EIA-29-DAL EIALCTLSAFNLGAINALDELEELAALAVRALDAL 47 14 30%
3296 GAG-25-LAL GAGKGTLLGAGAGALALSLGDSGAAARVLAL 85 11 13%
3297 GVG-25-VGL GVGKTTTSAALAAGLALRGNKVAVVDFDVGL 50 17 34%
3298 GIS-27-ALG GISLIVGGILVMNIMLVSVIERTREIGILGALG 47 12 26%
3299 LDA-29-ALL LDAVKAAEARKRLLAYPAEFSGGFRQRVAIAMALL 83 10 12%
3300 LDA-24-SLA LDALEQALWARRPSGTVHHSDKGSQYVSLA 57 37 65%
3301 LGI-24-GEI LGITFVFVTHDQEEALAMSDWIFVMNEGEI 46 15 33%
3302 LLE-24-GIT LLEITDKKTPRLEALQELDNVLLEGVQGIT 37 10 27%
3303 AIV-27-ALG AIVRALALELSVGMTVITGETGAGKSIALDALG 60 16 27%
3305 IGA-24-IAA IGAGGGAGLSDIANLLKPALAAGSLRTIAA 61 11 18%
3306 GGI-25-SAI GGIYNFVTKRALCRGENSKISWTQVETGSAI 39 24 62%
3307 VGI-27-LNA VGINNAVNKVPGIRSALVRDMTSALYSKEELNA 33 19 58%
3308 GLV-24-FGL GLVTTSRIILVALAKKFVVAALGVLLGFGL 47 14 30%
3309 GIL-25-SLG GILAIGANKMAAGLDPLIVGKLLKGIGLSLG 44 12 27%
3310 GSG-27-GLA GSGIVEFSRKFPDLYFDVAIAEQHAVTFAAGLA 56 16 29%
3311 VAI-26-GGI VAIVGGSKVSTKLTILESLSKIADQLIVGGGI 40 20 50%
3312 AFL-24-GGI AFLNRGLTISIEDKREGEEQEEEFHYEGGI 38 24 63%
3313 NAL-29-LNA NALYFADGDEALALDLADEMIHQRYQPATPSFLNA 37 18 49%
3314 SIA-28-ELA SIAVDIAFVLHVPVAKLADLHLRKRDAREIKELA 42 5 12%
3315 ALN-28-IAG ALNNGTLQHPVGGVHAGSGVSGQGKSELTGIIAG 41 19 46%
3316 TLG-27-GKL TLGLAFLLAIMETVYVLTGKQIYKDMTRFWGKL 38 18 47%
3317 LIG-24-EAL LIGDVVTNAIVLIDRVIDEARGGMEFKEAL 53 9 17%
3318 AIA-26-VLS AIARALAMNPDVLLFDEPTSALDPELVGEVLS 59 18 31%
3319 GLA-24-IVV GLAAIDGVLIAGQVATIWTLETVVIRGIVV 48 10 21%
3320 VSL-25-IGL VSLIVYFGFIYALGFSIGRGLLALLVLVIGL 49 6 12%
3321 LLF-25-AIV LLFLYLGDITLDIALYDNTPAASVAAGLAIV 42 20 48%
3322 LLE-24-DLI LLEDIGETVELASGGEQAVDRAPQMAFDLI 49 13 27%
3323 ILL-24-TLL ILLEFLAGLVIAILFLLRRFSIVAAGLTLL 69 10 14%
3324 ELA-27-GEL ELADDGALLLRSETELDEAEQAPLLLLLLEGEL 55 7 13%
3325 AVL-27-FLA AVLGAWALIEKAALFFVLLLDVLLGAVLAAFLA 54 6 11%
3326 VLV-25-GVL VLVAACPCALILATPTAGVAAVGRAARAGVL 59 15 25%
3327 LVG-26-LLI LVGLIGLFIRAGALLAEKFSALAAALLKGLLI 63 5 8%
3328 PLL-24-ALE PLLALRDLHVYPATVIPLDVERLDSDEALE 52 10 19%
3329 LSL-27-LTL LSLDAALGAGGLPMGRIVEIYGPESSGKTTLTL 70 13 19%
3330 LLI-26-GLG LLILFGVGAVAALAAGGGSFGLLEIAALAGLG 58 9 16%
3331 VLN-29-ISA VLNGIDLPITEGERAKVQIVEAITDDAAGAVGISA 33 17 52%
3332 ALA-25-FGL ALAALVAAPAVATAVALAIDAAFGLGAAFGL 67 2 3%
3333 VLV-27-GLA VLVNNFVLVLFLGLLLAMGVGKVLEGAIGMGLA 70 10 14%
3334 GLA-28-DLL GLADRLEFVPDPLSIIQAIRVTLAGALADAADLL 53 12 23%
3335 GLV-26-VLS GLVHISELGHNLVEKPEVVLSVGAEVGVKVLS 48 17 35%
3336 GAL-24-VEL GALIALYEHKIFVQGVIWNINSFDQWGVEL 44 23 52%
3337 NLL-29-IGL NLLLRVGETDDIDHLGNRRLRSVGELLQLQFRIGL 45 11 24%
3338 LLI-26-TLG LLIFDEVITGFRLPLGGAGSYFGLILDLLTLG 50 10 20%
3339 ALG-29-GLD ALGFLAEVAAAQFGFLLEAMDYGFPPHGGLAIGLD 55 14 25%
3340 GAG-29-ALN GAGQHGVATATAAALFGGECLIFMGVNDVVRQALN 42 16 38%
3341 GAI-24-GIA GAIAVRFVVKVLIVGLGLLEAAGFAGAGIA 47 11 23%
3342 SGI-27-ASG SGIRLKVIEALIALVNAGVYPLIPLKGSVGASG 41 15 37%
3343 LDI-28-LLN LDIDALKVVSKGVNEMRGEEFGALIITHYQRLLN 36 25 69%
3344 YGL-27-LVD YGLGSPEEYADSVVSLRVGMEISRDQLLRKLVD 32 24 75%
3345 VVS-24-LLA VVSLLGISIGTIVATLPLPLTIIATGALLA 66 12 18%
3346 LGL-27-GIS LGLLGTVTGMIATFQTITTVGIGAAKGMATGIS 52 20 38%
3347 LIA-28-TLG LIALLPALAAIGVDNIRPWSAIEPLLSGFGYTLG 51 6 12%
3348 ALI-29-LGF ALIALPSGSATLEAIDQSNATLNTLSAGWLKDLGF 49 11 22%
3349 LSG-25-VGL LSGGLSRRVAIAAALLGDPELLVLDEPTVGL 50 17 34%
3350 ALV-24-ILL ALVGLSGAGKSTLAFLLARFYLTDAGRILL 65 15 23%
3351 LSV-24-ALE LSVALALGHAGFAIGAIDAALLARELAALE 44 11 25%
3352 AIG-28-LLG AIGLGLAPLLLFIVAGADTVAALLLLAARLLLLG 69 6 9%
3353 GEL-28-TLL GELHFLSDDDLLILSLTGGPVHVTDASNASRTLL 48 21 44%
3354 TLG-27-GSL TLGIPVDLPTALLLSVVAALCACGASGVAGGSL 44 15 34%
3355 EAL-29-LID EALLALLDLVRLGLLQLALQDAEDIASAVIDKLID 50 6 12%
3356 IAL-25-LFG IALAYAKGIGVTRAGVIETTFKEETETDLFG 51 15 29%
3357 LLK-28-ILA LLKQSGTFRENEEVAERAMDSNDIEKERGITILA 53 25 47%
3358 VLG-28-ILV VLGMLGTGIGKTAAFLLPLLFNLTPALKALPILV 53 9 17%
3359 LIE-28-AIA LIEANEAFAAQALAVGKELGFDEEKVNVNGGAIA 50 30 60%
3360 ILA-26-VID ILAAGKGTRMYSDLPKVLHTLAGKPMVQHVID 41 19 46%
3361 EVL-27-GDL EVLLHIGLDTVWLMGDPFEFDVKSGQRVAAGDL 38 18 47%
3362 SLG-24-EGL SLGLLTINALTAADSVLIPVQCEYYALEGL 40 20 50%
3363 LTG-24-IVD LTGLSNVVLLDSAEGTSRGKDLRPYLKIVD 41 11 27%
3364 ISA-25-SGG ISALGRSGLNIEGRENFIQTDAAINPGNSGG 37 28 76%
3365 DLL-29-ALA DLLATVGLISAAAPGKPHEFSGGQRGREGAARALA 94 16 17%
3366 ALV-29-AGI ALVILAGLAAGLIAGAQALISSSMSNTELALAAGI 64 12 19%
3367 ASL-27-SAL ASLSGGQQQRVAIARALAADPDVLLADEATSAL 69 15 22%
3368 GGG-29-ALA GGGNIFRGAAGAALGMDRATADYMGMLATVMNALA 93 23 25%
3369 VAI-28-LEL VAIARALALNPKVLLCDEATSALDPATTRSILEL 42 29 69%
3370 LGI-29-SGG LGISEGEIGTQLGLALIFVLLLEDGDYPPLALSGG 46 13 28%
3371 ELA-25-GAG ELAMACDIRIAAENALFGQPEIKLGIIPGAG 54 28 52%
3372 LGV-27-DLL LGVQRFDYGRADEANRVGQVTGLAWTEVGGDLL 50 17 34%
3373 LLT-27-GVI LLTRYNPGRVEKGEMLSIEDVLEILRIKLVGVI 50 21 42%
3374 LVG-25-LAS LVGLADKSDLYPANLSGGQKQRVAIARALAS 58 15 26%
3375 GGG-25-GVV GGGRKPWRQKGTGRARQGSIRSPQWRGGGVV 60 22 37%
3376 SGV-26-VVL SGVDALIGLTDDLVDYAAQNDLNLGAIGPVVL 46 14 30%
3377 ELL-26-VGK ELLETGIKVIDLMCPFAKGGKVGLFGGAGVGK 43 21 49%
3378 VLL-27-LVD VLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVD 54 26 48%
3379 GLG-26-GGI GLGILLAYMLFGKGTAKQSAPGAAIIHFFGGI 50 26 52%
3380 LSA-29-AGI LSAMVGIARFVQDKDLDKILRADDVLGTEATRAGI 54 9 17%
3382 LVD-24-LAA LVDRGVGPALGAGLAVVGAFGGALLFLLAA 72 6 8%
3383 RLI-26-LLL RLIGAPPGYVGFDQGGLLTDAVIKHPHCVLLL 51 26 51%
3384 IVD-25-TLG IVDHFTYVFMGDGCLMEGISHEACSLAGTLG 32 20 63%
3385 ALI-24-LGI ALIGLGILLIGALLLFMTSSLLLALALLGI 63 13 21%
3386 LGA-24-LDG LGASGCGKSTLLRMLAGFEQASSGDITLDG 51 21 41%
3387 GGG-25-AGI GGGIGIQLANSFLLLVWTLIISIPLGIGAGI 60 25 42%
3388 GAG-25-SLV GAGPGDPDLITVKGARLLENADVVIYAGSLV 45 28 62%
3389 AIG-27-IGL AIGAWGLGFISDVDAILHFSLLGVVMLMFAIGL 55 12 22%
3390 NAL-26-SGL NALMYHIKDLSGINGVVRPGIVHRIDKDTSGL 41 12 29%
3391 LGT-24-GIS LGTVTGMILTFAVIAVFGLGDPKLMASGIS 36 13 36%
3392 VAL-25-VLV VALVLAALAGGDGLLLELGGGLNIHIGLVLV 68 7 10%
3393 LVV-25-LIG LVVATTFPAGLLGDLDVAVNPEPLRACTLIG 54 22 41%
3394 LIV-28-ILG LIVNTASECGFTPQLEGLQPLYAKYGGQGLLILG 49 11 22%
3395 PLL-24-IAA PLLIIAEDVEGEALATAVVNKLRGGLAIAA 57 11 19%
3396 ADL-27-ADL ADLSGADLRGADLRGADLRGADLSGANLSGADL 77 48 62%
3397 LGI-25-AFL LGINKAVRNGLNSDGSLSARAIIRYALPAFL 51 21 41%
3398 LVD-28-GAL LVDELVLVSEDEIGNAMIDLIQPTKAVTEGAGAL 52 15 29%
3399 ILD-26-TLL ILDEADEMLDMGFLEDIEAIISEVPERRQTLL 40 21 53%
3400 VVI-24-LAL VVIGSSAGGSAAQVIGVFNGRGPDVLVLAL 52 9 17%
3401 AGL-26-VLV AGLFVGRGIAIPTAAALLLLAYALAGDLLVLV 72 13 18%
3403 GLL-27-ALV GLLAGLLGGLGIGALLALVLAALALFAAGLALV 89 2 2%
3404 ELA-26-ELV ELAAQEFPDLDVSLRGAVSIARRLQDPLAELV 52 31 60%
3405 VIA-27-LIA VIAAAGTSALEIKELIKLGDNVRVLARGGGLIA 58 13 22%
3406 SLG-29-GLV SLGATPGLASRPALATHGVIGLKPTLGSGITDGLV 63 22 35%
3407 LVV-25-VAI LVVAADDGVMPQTIEAINHAKAANVPIIVAI 43 27 63%
3408 DAL-26-VEL DALLPTLGGQTALNTAVALAENGVLEKYGVEL 47 21 45%
3409 GIL-25-LDG GILDPEDARDAVRFGADGIVVSNHGGRQLDG 37 24 65%
3410 VDL-25-ELI VDLLAPYIKGGKIGLFGGAGVGKTVLIQELI 40 22 55%
3411 GGS-28-SVL GGSGTRLYPITRGVSKQLLPIYDKPMIYYPLSVL 42 22 52%
3412 LGG-27-VLI LGGRGGGIVYNEEELLEIMERAVKVSPDHPVLI 50 21 42%
3413 RLL-26-AIL RLLALDLGLGKLDGIAIVSLRAAEIAKLLAIL 51 6 12%
3414 VGL-29-RLL VGLAERAGRWPAALSGGMQQRVALARALAHRPRLL 54 25 46%
3415 GGG-29-ALT GGGVALGLPVGILVLALGLYFVPALSGSALIKALT 51 12 24%
3416 GGG-25-IGG GGGVAGITAALLLALAGFSVTLVEAAGAIGG 56 20 36%
3417 LVF-28-LLI LVFFGALGIAPFTTGQLVILALISLAALGVGLLI 46 16 35%
3418 IAL-25-VLL IALVTGLAGGKPMLGTLWVWDARLLSELVLL 75 10 13%
3419 TIA-27-AAL TIATGFVVDDAIVVLENISRYFEAGMKPLAAAL 60 15 25%
3420 LLG-25-LGG LLGGLGVGKSTLLLALAGGFVPLALAILLGG 81 7 9%
3421 LLV-28-LAK LLVALEVQCGAGRTGGLFGKLTEFEVPDAVTLAK 52 15 29%
3422 ALE-27-LIE ALEGALKGKELAYEHAEGFAAGELKHGPEALIE 50 10 20%
3423 GAG-25-GIA GAGMMDCKKALAETEGDMEAAIDYLREKGIA 56 20 36%
3424 VIL-24-LGV VILALVKLLAAVPEQLLGIKAVLLAPALGV 48 6 13%
3425 EAL-26-LEL EALEAGAEGLPAAIALLMAGNRLSERVRLLEL 65 6 9%
3426 DLL-28-VLA DLLPADITGTSIYDPKTGEFEFLPGPIFANLVLA 62 20 32%
3427 ILL-27-ITL ILLAYAFKRPLSSYSAAVVAVFKATSLAITITL 47 7 15%
3428 LGV-25-LAS LGVAPFTLALPYAILLGTAVLTVAIGFILAS 57 11 19%
3429 VLD-28-LLV VLDNPDLFLLPTLLDSALGLIRGRWLAFGRILLV 47 13 28%
3430 ALT-28-LAL ALTAALLGLPVVGVAAAERGVVIANSLRAASLAL 85 4 5%
3431 FLL-27-FLL FLLRIEDLMESIGRIINLALFLSKRGGGLAFLL 50 8 16%
3432 GVI-28-LIV GVIFFLGRKQSRAGQLGRVFIGLGLILLALALIV 40 8 20%
3433 ISG-26-SLL ISGFAANIKPIAGGMLLETLIAADRVSTISLL 48 13 27%
3434 AIG-28-AVL AIGDLYMAGHGIIGAFTAYKSGHALNNKLLRAVL 64 16 25%
3435 ILD-28-ILL ILDELLSGLDPTIIRVGIDVIKLLADLKTMDILL 43 8 19%
3436 IAD-25-PLL IADFTPTDEFIRALGLFHARFLLVGLFTPLL 35 6 17%
3437 ITA-26-GIG ITAGGAWGEVGRTFRGKGHDVGELDVIVQGIG 37 12 32%
3438 GLL-27-LEL GLLTYPVLMAADILLYNADLVPVGEDQKQHLEL 53 15 28%
3439 LLT-29-VVS LLTSEEEKELAKAVEAGDLEAKQRLAEANLRLVVS 42 20 48%
3440 ILD-24-EIL ILDPALLRPGRFDRLIYVPLPDAKGRLEIL 41 17 41%
3441 LEV-26-LLR LEVLKGVALDIARGEFVALEGPSGSGKSTLLR 44 13 30%
3442 FLA-28-LPL FLACLQGIVFSAQDAANIGAAAGILPFKGLTLPL 45 10 22%
3443 ILL-24-VIV ILLDIYMLFENGLDLLDALHAAGCKIGVIV 45 8 18%
3444 LGV-29-VLA LGVGPLVISHGAGSGAQNAVGTGVMGGMVTATVLA 80 20 25%
3446 LVV-24-GIL LVVACPCALVIAIPPAFLSGIANGARKGIL 44 16 36%
3447 LVD-27-EAL LVDDEPEILDALEAALAQLGYLVLTAASGEEAL 55 15 27%
3448 LLG-27-LFG LLGILAHSALSLGLVVVSLMSNVRVDLMAYLFG 62 19 31%
3449 GAL-25-SLA GALVGGTLLLRRGGLRGLVGTVRLAGAVSLA 62 8 13%
3450 LSL-25-GGI LSLIFWILILVVSIKYLTFVMRADNAGEGGI 49 18 37%
3451 VLA-27-LVD VLAGTFDAMAYLGIALQRISLGALIIALGLLVD 57 16 28%
3452 GGI-24-TLL GGIGRAARNWECFDAIVEVLKRLEDDETLL 43 21 49%
3453 LDA-29-EAI LDALTRLEMQDLLLDLWEQDKFTVLLVTHDIDEAI 46 28 61%
3454 ILL-28-VLI ILLDEPFAGVDPISVIDIKKIIEHLRDRGLGVLI 55 23 42%
3455 GLV-28-GIA GLVGALLAVADAALLCKKVAPLWIILFFIVLGIA 58 6 10%
3456 LVE-25-LAA LVELVVARIATAAETIQGFGGLIALPAALAA 84 8 10%
3457 VLE-28-LVG VLEGGFGVVAANAEGWRTTPSEVAADAGGAKLVG 43 23 53%
3458 SGG-28-LTG SGGFTYFTDRLAEELGLDYVRANRLEIVDGKLTG 45 30 67%
3459 ALI-28-ELG ALIPFITAGDPDLETTVAVMHALDRAGADVIELG 45 16 36%
3460 LIE-29-GLI LIERNLRLVVYIAKKFENTGVGMEDLISIGTIGLI 40 25 63%
3461 GSL-26-GEL GSLQAGALTTTYTASQGLLLMIPNMYKIAGEL 40 12 30%
3462 IAD-29-ALT IADEIATGFGRTGKLFAAEHAEIAPDILCLGKALT 38 9 24%
3463 VSV-27-IAL VSVPVSIIAIHLLADVLQAEADALAGLIYAIAL 42 13 31%
3464 LVF-24-GLL LVFITSLVFLPAILLLVLSFTRTIIVLGLL 57 8 14%
3465 LVG-27-LLS LVGFAALFLVLLGDQQSAFPGRAAFPMALVLLS 66 12 18%
3466 LLV-27-RIL LLVLARTFLNPNLSRSALDRCLRRHGVSNLRIL 44 12 27%
3467 LLI-29-ALV LLIADEPTTALDAGILAQIIELLLTLQVTLTMALV 63 9 14%
3468 AIA-26-LVV AIALAAGAMADIGLALIVATLDAALAGMSLVV 60 9 15%
3469 LAS-25-LVE LASSAAGAAESSGGLISDAGLAATHNSDLVE 47 12 26%
3470 ALV-29-IAL ALVLMGTGGALSLPGLLPALLGLGLLAVVSAAIAL 70 14 20%
3471 VGI-24-VSL VGIATGKNDVVAPSELLSDVPYAIVDGVSL 43 13 30%
3472 SLL-26-VIG SLLVAFLLLAALYESISVPFSLGLVVLLGVIG 52 9 17%
3473 LAK-25-GKL LAKTAGAPVAASLRQRRERYDSKTAIGSGKL 43 12 28%
3474 GAG-28-ILV GAGPIVIGQACEFDYSGAQACKALREEGYRVILV 41 26 63%
3475 LVI-25-VIL LVIADSGATPDFVASDLLSQAEHGPDSQVIL 41 11 27%
3476 ELG-28-DIL ELGRTIMTIKELLRLTQGSVVALDGLAGEPLDIL 40 15 38%
3477 PLL-27-LEV PLLAQLKQQLHAEAPRAEGVVKATEKGFGFLEV 36 12 33%
3478 LGT-27-EVL LGTIVFLRLDFDAGHNLATQVLTSQGVIFAEVL 42 13 31%
3479 IVD-28-ALE IVDDEPDIRDALEFKLEFEGFDVSDAANGAEALE 38 14 37%
3480 LSL-24-LVG LSLLAAALTLSAAEAIRGRLATQAGAGLVG 64 8 13%
3481 ALI-25-GIV ALILGRLGAIGALDWAAADSARLALREIGIV 63 18 29%
3482 IVL-29-LDV IVLTGSAAEKSTRGEVLAVGNGRILENGEVKPLDV 35 19 54%
3483 LIV-26-LLG LIVASLILLVLELITLLLLALLLAGGFLLLLG 62 4 6%
3484 GSL-25-IAG GSLGLLPSASLKRGGIALYEPDHGSAPDIAG 43 9 21%
3485 IEA-25-SGI IEAAKSMGATRWEIIRKVLLPEAMPALISGI 34 16 47%
3486 ILD-29-ALS ILDPGSTILGLADSKKLSENRTVITNSEIAEKALS 41 19 46%
3487 NAL-24-ATL NALLKTLESHPRKKQIFLAIREPARLLATL 41 7 17%
3488 LTI-29-ALK LTIETGIVFDDALLVIENIGRFSEHGNWPLAAALK 35 15 43%
3489 IGS-29-LLI IGSLLAVLILLLIANPSQVLGLGTLIGLLLISLLI 43 6 14%
3490 ILA-26-ASL ILATLVAGALLAILLLAVPAGIFLAVLNVASL 55 5 9%
3491 GLG-29-ALG GLGAAVAQAIGAAVLPLAALGIGAGAIAALAAALG 81 12 15%
3492 IGL-29-LEA IGLYNSKAENVIKTCRILLEKHNGEVPEDRAALEA 45 22 49%
3493 GLV-26-GAS GLVTWETQQTDYPRTRPDLPNHEPRGCPRGAS 46 10 22%
3494 IAA-29-YGL IAAAVGGGVSFSGGVGFVRGVVTGVLIETVIIYGL 36 19 53%
3495 LVE-25-VVL LVERAGGAPTQDDALLSLLPGVGLALARVVL 46 2 4%
3496 LVE-26-GGS LVERTKTPVRQALSDAGLSLSEIDEVILVGGS 38 24 63%
3497 LVV-26-VLN LVVDASQGVEAQTLANCYTAIENGLEVVPVLN 36 30 83%
3498 VGL-29-LVG VGLDYLTLSRSAETLSGGEAQRIRLASQIGAGLVG 60 33 55%
3499 IAG-25-GEL IAGCMVTEGVIKRNAPIRVLRDNVVIYEGEL 41 26 63%
3500 LIV-28-LAK LIVIDYLQLIKGLRPENRQQEVSFISRQLKILAK 44 10 23%
3501 VIL-27-LLF VILGQVWAFIAPALLKHERRLVVLLLVLILLLF 45 7 16%
3502 IAS-29-LGG IASGTLAPLELILSFGATSSLLAIAVLLLVSGLGG 46 9 20%
3503 NLL-24-LDG NLLMGRELQKAYGQKPQVVLTMPLLEGLDG 37 18 49%
3504 IPL-27-LGL IPLVLADTFAFMEISGISLQRISLGALIIALGL 50 16 32%
3505 VIA-27-GLA VIAQLLGLDALGSPVDIALYVNSPGGGVEAGLA 72 19 26%
3506 IVG-27-GIT IVGPRPHAVAHNEQYRQLIEGYMLRHKVKPGIT 39 17 44%
3507 TLL-29-GIA TLLRMIAGLEEITSGDILIDGTRVNDLPPSDRGIA 53 28 53%
3508 ALG-27-GGI ALGGQGAPLVPAFHHALLAILTAGRVVLNIGGI 63 12 19%
3509 VGI-27-SAL VGIENRPAIVDQKSRIGDWEADTIVGKGQKSAL 42 15 36%
3510 AIA-24-ALS AIASLGAGKQALLAVLALLAALRGAPYALS 70 10 14%
3511 LVG-24-ALG LVGPPGVGKTSLGGSIAKATGRKYVRMALG 71 26 37%
3512 LEL-25-LLL LELLKQGRGMRIAPLVAATGLLVAQDATLLL 69 6 9%
3513 LID-26-LLA LIDEVHMLSRHSFNALLKTLEEPPEHVKFLLA 54 18 33%
3514 FLL-27-ADL FLLYNWKRKGVKMRSLDLVYPLRLPLLVEVADL 37 15 41%
3515 GIS-28-ELA GISVSRVGGAAQTKIIKKLSGGIRTALAQYRELA 44 26 59%
3516 VVI-26-VLI VVIALAAAADWMFFGPAPLAVYRLLVAITVLI 41 8 20%
3517 ALN-29-GIA ALNIIHYMHDKYSYEASLMALHDRDVIRTMACGIA 38 18 47%
3518 IAA-27-GIA IAALVVALLPAFTLAFSALFGIATLKLLGVGIA 58 7 12%
3519 AAI-24-LGV AAILDGDAAEIDGAALWSRAGLDLLALLGV 59 6 10%
3520 AAI-24-AGL AAILGGLALEWLLGGKAPLLAAAALAIAGL 77 13 17%
3521 LLD-29-IGA LLDINDLGLPAATEFLDMITPQYLADLISWGAIGA 47 20 43%
3522 LAA-27-AIT LAAPDIIVRNEKRMLQEAVDALLDNGRRGRAIT 53 15 28%
3523 VGL-29-ELL VGLAGRGNKLPRQLSGGEQQRLGIARALAMQPELL 51 19 37%
3524 GGS-24-DAI GGSGKQARSVIDGIEADVVTLALAYDVDAI 35 18 51%
3525 LGL-27-EVL LGLTAFDLIIDQSATAEATARAAGVVLLVPEVL 58 7 12%
3526 TLL-24-LGT TLLSALTGIALFVADKDLKKILRLTDTLGT 46 12 26%
3527 GLG-27-IAV GLGFLWFNTYPAQVFMGDVGSLALGGALGTIAV 49 18 37%
3528 LAE-25-AIL LAEIASTTNENILTEALLGLAKDEKERFAIL 57 10 18%
3529 IAG-28-LVF IAGLEVERIINEPTAAALAYGLDKTDKDEKILVF 37 30 81%
3530 ADL-24-LLV ADLEAAADGAVAALFAAAGQPCVAGSRLLV 52 13 25%
3531 VDL-26-GIL VDLTVELEKETTYEEINAAMKEASEGELKGIL 33 22 67%
3532 ITA-28-GVG ITAFETAFGRLRGGLRNGSLPIALLLIGGAGGVG 35 6 17%
3533 IVD-27-VSV IVDANLVMDMPKSLTAFGGLDAVTHALEAYVSV 32 22 69%
3534 ALI-27-IEL ALIPFITAGDPDLEITVAVMGALERAGADIIEL 40 13 33%
3535 VVL-25-LIV VVLVVAADDGVMPLILEMVAHAKAAGVPLIV 49 9 18%
3536 GLV-28-LLF GLVLDPYFSGTKAKWILDHVEGARERAERGELLF 51 22 43%
3537 EAI-25-GLD EAITKGLPIPKPGVPESFRVLVKELQSLGLD 47 14 30%
3538 IVG-28-SGG IVGAGLNHWYHIDMNLRGLINMLESCGCVGQSGG 38 9 24%
3539 AKL-27-EAL AKLRVQLRTEIKKLHQELGITTIYVTHDQEEAL 51 22 43%
3540 GEL-28-ITL GELVLVDGKWTYTLDQSQAQQLDEGEKVQDTITL 41 14 34%
3541 ADL-24-VLV ADLAKAASAIVAGAFGYSGQRCTAAKRVLV 49 13 27%
3542 GAS-27-LEA GASGGIGELFAKKGVRVGAGLDLDARREQRLEA 43 19 44%
3543 EVI-28-LLL EVIGTAIAQSLLGGIPLITGIIITAEAVQLSLLL 44 23 52%
3544 VLN-26-LIA VLNMMNQDGVRNGYDLEQLKKVREVCRVPLIA 38 19 50%
3546 LGL-24-SLL LGLIAGYFFGLVGAIIMRLVDIMLALPSLL 88 14 16%
3547 LSA-28-LLR LSAVSGNALGKAVLMILALIGRGTLARAIVALLR 56 11 20%
3548 VIA-29-AGI VIAGQGTIGLEIMGLLYDVDNVIVAAGGGGLIAGI 49 9 18%
3549 VLD-29-AGL VLDGIDLDVAEGEFVALLGPSGCGKSTLLRLIAGL 57 26 46%
3550 LAT-24-IAA LATGASAIEAATYLLLRGALGGTLAALIAA 65 7 11%
3551 AIE-27-GAG AIEALRARLRPILMTSLAFILGVVPLVVATGAG 41 9 22%
3552 GLD-25-LVG GLDKVKERILEYLAVQLRAKKIKGPILCLVG 44 17 39%
3553 GID-27-LLE GIDLEIKPGEVVAIIGPSGSGKSTFLRCLNLLE 41 30 73%
3554 DVI-27-VIL DVIVFVVSGKEGDTDADEYVAKILYRTNKPVIL 33 13 39%
3555 VLG-28-GVV VLGYLLAGIAIGPWGLGLVTDVESILHFAELGVV 55 28 51%
3556 GLI-28-LDA GLIGFTNALKSTIMNFLTGATRYEAVELFATLDA 41 8 20%
3557 LTG-26-ALI LTGSLKGKKRREGLEQLATGEIDLLIGTHALI 51 18 35%
3558 TIA-27-ALV TIALALFACFDKAKVVPFIIPQVAGAFCAAALV 46 11 24%
3559 LVL-25-LAS LVLCPINLSALGRLAVILVDARGVLKELLAS 65 10 15%
3560 EIL-24-LAT EILPVVEAVSNEKQLPREKIFEALEIALAT 40 13 33%
3561 LDV-26-IGV LDVSLRGAVSIARRLQDPLAELVKIDPKSIGV 33 31 94%
3562 LAI-28-AAL LAIALAALTLAGPAGSSAKLKLDKTIGALVLAAL 86 7 8%
3563 VIV-25-RLI VIVLNPGNLATIYQSLKKTDKEDSLKIARLI 36 20 56%
3564 IPL-24-LDG IPLIVTNCIVIGRAEAFASKNGPLLSALDG 32 14 44%
3565 LSL-29-LLN LSLSILRLIEEEALKENTQEVHAIVPVPIASYLLN 53 19 36%
3566 TLL-24-ELG TLLKIISGILVPTPGEVRVRGRVAALLELG 45 20 44%
3567 VLA-26-VLN VLAGCENMPGGAAYRPGDVLTTMSGQTVEVLN 42 12 29%
3568 IGG-27-GGS IGGGTGLGVILKGLRKADVDITAIVTVADDGGS 45 21 47%
3569 ITA-29-AIA ITAVADAAEAAEETGIPVIADGGIRFSGDIAKAIA 48 19 40%
3570 IGS-24-LAL IGSLLGASAAFLAVVDLVSKIPDIGLKLAL 54 9 17%
3571 LLL-26-GSL LLLGLGLALAGDGFLAAAAGSLLGGVGVVGSL 72 6 8%
3572 LLG-27-GLS LLGILAGGALLLGVLLVLAALDTAAALFLAGLS 67 7 10%
3573 LVL-24-VLT LVLDATLGQNGLAQARVFALVLAISGVVLT 58 12 21%
3574 LGI-29-GGG LGIPLKDLNDVDSLDLTVDGADEIDGDFQMIKGGG 46 28 61%
3575 GLS-26-VAI GLSVAFDLATHRGYDSDHPRVAGEVGKAGVAI 47 25 53%
3576 GAG-25-VLF GAGKLIELLFGLNYHVAVVLVGVLMMQYVLF 39 14 36%
3577 VIL-29-LLI VILDEFAELSLSADLALALLLDVQMLLLLALFLLI 51 7 14%
3578 GEL-29-GDL GELAVRGPNVMKGYWNNPEATAEAVTDGWLHTGDL 44 22 50%
3580 IVS-28-GAL IVSALGRSGLNIENYENFIQTDAAINPGNSGGAL 43 28 65%
3581 AVL-24-SLG AVLLFELASLAALRALTGLVALPVFAVSLG 59 9 15%
3583 GGG-27-LAL GGGRLIGLGLALGGPLLPGIGLALGAERTFLAL 85 15 18%
3584 LSV-27-ALL LSVIILATALLAVTAELALGLAFTELAPFTALL 77 12 16%
3585 LGI-26-LPL LGIRQVPLDLIEAARAFGASPRQLLFKVQLPL 52 24 46%
3586 LIG-29-GAS LIGLIAYRSTNNLDDYILGGRSLGPFVTALSAGAS 43 16 37%
3587 LLK-28-LIA LLKDDAAVDLALATRVRPAGKALLAPIVTLLLIA 51 13 25%
3588 LAE-25-ASG LAEGPALAVHQLAASLALTDEWVVRKLTASG 54 8 15%
3589 IGA-27-SLA IGARLTELQTFRTMASGASANVGFALGASGSLA 52 8 15%
3590 LVI-25-LIA LVITGFHQTTLAIDLQLIQSGGGTPIWPLIA 49 9 18%
3591 SIA-25-EVL SIARALAREPEVLLLDEPTSALDPELVGEVL 40 18 45%
3592 GAS-28-LVL GASADLAGGLSSFMVEMRETANILHLATIISLVL 49 17 35%
3593 LAA-27-GLI LAALGRGLLLPLLESDAAIARALAPTLALKGLI 83 12 14%
3594 LEL-26-LNA LELGGKSPAIVDADADLDAAAKRIAWGKFLNA 38 19 50%
3595 GIA-26-VLE GIARALADAPGVVLADEATSALDPGEAIEVLE 40 10 25%
3596 LVL-26-IVL LVLLLVELSDVIFAVSSIPAIFAVGTLPIIVL 55 8 15%
3597 LLD-24-GIG LLDEPFAGVDPISVGDIQRLIKHLKSRGIG 41 25 61%
3598 DLL-25-LIG DLLLERSTAITALAILKSIEAGVDGLALLIG 52 7 13%
3599 GLS-28-GAG GLSKRFGGLKALDDVDLTLAAGEIVALLGPNGAG 54 26 48%
3600 AVL-24-GEI AVLIVGASTMNGFERALNNNILLFVPHGEI 45 7 16%
3601 AGI-24-VVL AGIIGVARLQSAAATAGGGYELDAIAAVVL 50 12 24%
3602 GIA-27-GEL GIALGKLAAEDPSFRVETDEETGQTIISGMGEL 44 27 61%
3603 IGA-26-GGI IGAGFAGRQQAGRELGDEVTPGGFLSGVLGGI 44 9 20%
3604 IGG-25-VLD IGGDGIAIDIGSGGLDHVLISPAYTLPLVLD 40 25 63%
3605 VIE-28-VAL VIELKRDAVGEVVLNNLYSQTQLQVSFGINMVAL 37 26 70%
3606 ALL-27-GSG ALLAVADKTASLIITGNGDVIQPEDDLIAIGSG 67 23 34%
3607 VVL-27-AIA VVLACTHFPLLGDLLLALEPEGIDLVDPAAAIA 64 12 19%
3608 LAT-26-LAE LATSESWRDKATGEAKEQTEWHRVVLFGKLAE 60 15 25%
3609 GGI-27-LAA GGIAEALAIAREAEAGDVGLAGACALGAGALAA 67 8 12%
3610 LLV-24-GIV LLVLAVAVLLGITDNAIPKALKAMVLIGIV 58 7 12%
3611 IAL-24-LIA IALSLLILLVALVAGRPLDILLEVAVLLIA 69 4 6%
3612 LLI-25-SVV LLIVLGTSSSESALPRMLDKMEKLGCSKSVV 42 18 43%
3613 LSG-27-IAG LSGNRNFEGRIHPYVKAAFLASPPLVVAYAIAG 52 20 38%
3614 ALE-25-VAI ALELLKLVGLADRADARPSELSGGQKQRVAI 47 28 60%
3615 GLG-29-AIA GLGARLLVALIGALADRGRIVLLLEVLAANAEAIA 74 13 18%
3616 AVL-26-FLL AVLELSLAIFKMGALLDVNVASLGVAVEVFLL 52 6 12%
3617 VIL-24-GIG VILPYHLKLDELQEDAKGDNKIGTTIKGIG 42 19 45%
3618 GVS-27-LSG GVSKAEARKRAEKLLKKVGLAEKADRRPSQLSG 48 18 38%
3619 GLF-24-SLG GLFETGAGGSAPKHVQQGVEENHLRWDSLG 41 15 37%
3620 LGG-27-LLS LGGADVHATLSGVAHFAADDEEEALALVRRLLS 62 21 34%
3621 NAL-26-ELA NALYHAFPLVDHGDVSRVRYPGLRGHPLLELA 43 13 30%
3622 LLG-29-IEL LLGKRVDASGRSVIAVGPTLKMYQCGVPREMAIEL 43 14 33%
3623 LLG-27-GLF LLGAAEAGFFPGILPDLSPEFGLLLIRSALGLF 53 17 32%
3624 ALV-24-FLL ALVAAAGRMAILGEIILDILLAGLALGFLL 52 5 10%
3625 GLS-27-IGG GLSGLITPSLDEMVHVAKEMERQGFDIPLLIGG 48 26 54%
3626 LEA-26-LAI LEAMLIVMTGEDALLVSGNGEVIGPDAGLLAI 45 18 40%
3627 IVG-25-GLV IVGAIIGAIAGAITNKGGSMGWIANILAGLV 49 13 27%
3628 LFG-29-ALV LFGIIEGIAAGIALLGKAVLASKAARAINAGFALV 60 13 22%
3629 VVL-24-VVL VVLALSGPGAANALTGAAAALAVSIPLVVL 58 7 12%
3630 LEA-26-GAG LEAARLRLRPILMTSLAFILGVVPLVISSGAG 53 21 40%
3631 LEA-27-GDL LEAARAYWQALREEEKIAFRFHHISTDEVYGDL 42 15 36%
3632 AAI-24-GLA AAIGALLILGQLKAVALGAALVLLDAAGLA 74 6 8%
3633 GIL-24-GIV GILPVVGVPLPLVSGGGSALLLLMAGFGIV 52 8 15%
3634 VIL-25-SVV VILTVLHAGGKFGGGGYKVSGGLHGVGVSVV 38 19 50%
3635 GEL-28-GID GELSGGQRQRVLIARLLARVCFLLALDEPFRGID 35 15 43%
3636 LGS-29-GEL LGSSACILAAGLSALNELCGGGLNDFTLLAALGEL 41 9 22%
3637 ITA-26-AAL ITAFIAEAQAGKAIAASTLVQTIALAGLVAAL 63 6 10%
3638 ALG-29-LLV ALGAGLAGAVLSAGLGLLSLAVAAAAVAAGAALLV 89 6 7%
3639 AGL-27-LDA AGLIDGLFVGEALATGGAGLEAAVLLKAALLDA 84 10 12%
3640 IGL-24-NVL IGLPKEIQPRYGEIATRLSELGNQKSNNVL 35 10 29%
3641 ELV-24-GLD ELVFADCEVPAENALGEANTGVWVLMSGLD 39 13 33%
3642 IGG-26-GVI IGGVLEPLQANPIIIEDNCFIGARSEVVEGVI 46 19 41%
3643 LLL-24-DLI LLLASLSWLVTLTQDLFSILIAEASARDLI 54 9 17%
3644 SLL-28-LIG SLLYHLILLDEWRQAIEALRAALRAYGVNLHLIG 66 10 15%
3645 ILL-28-IGS ILLQVLDDGRLTDSQGRTVDFKNTVIIMTSNIGS 43 17 40%
3646 LGA-29-AIL LGAVLAVLLRGLPNDVYFKVGLLTAIGLAAKNAIL 64 20 31%
3647 ASL-26-LVL ASLPAILETATILALLAAALDLLAAAGLGLVL 64 6 9%
3648 TIA-28-LAI TIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAI 40 30 75%
3649 ALS-29-DLI ALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLI 42 20 48%
3650 ILA-28-AIL ILAVLAAGLKAAYFALIAREEGLMAVSFIGSAIL 57 7 12%
3651 VAL-29-DLL VALARALNGRPDILFADEPTGNLDRQTGDKIADLL 52 18 35%
3652 SLG-24-VIE SLGQNFLIDSNIINDIIRLADIDAGTGVIE 36 10 28%
3653 LDG-28-IAT LDGTLLNDNKEISSETKEVLKELQQNGHEVVIAT 33 16 48%
3654 LVS-27-LLG LVSSYSPAGDQPAAIAKLVAGLAAGLAHQTLLG 60 17 28%
3655 KLA-29-DLL KLAPALAAGNCVVLKPAEQTPASILVLLELIGDLL 45 20 44%
3656 AIG-26-LAA AIGGAEAAAALLGLPVSRGVIGIYLLRAALAA 84 6 7%
3657 GLL-27-GAS GLLLVGRLPDARRNAADLLAVGRGTAVNQDGAS 55 10 18%
3658 ALS-25-LEL ALSALLPAAEAAALDPTALLTPSATNIELEL 50 6 12%
3659 LLF-27-IAA LLFLDEAARLDAASIATLFELCERLEMQLIIAA 47 12 26%
3660 GVV-25-GIG GVVSRSGTLTYEAVHQLTEAGIGQSTAVGIG 41 18 44%
3661 LAT-26-ELA LATKYAELPQQVLAFLTDLAKRAAGQAEKELA 57 8 14%
3662 GKL-27-LDI GKLRLEYEANPMAFLAEQAGGKASDGGERILDI 44 18 41%
3663 TLI-29-GLI TLIVIVAVPIGLAGLLIGITLFLISALGLILIGLI 41 9 22%
3664 IDL-24-IAD IDLFQLLITAGAELTGATDLSNKSLRVIAD 34 11 32%
3665 GGS-29-IGL GGSVRLPRILGADSALEIIAAGLDVGDDLALEIGL 37 8 22%
3666 GAS-25-GGI GASAEVVAAALKIILADPAVKSIFVNVFGGI 38 18 47%
3667 SGV-27-IGG SGVHHLNLLDFQGDIRTCPKPVVAMVAGYSIGG 38 9 24%
3668 FGL-25-LLD FGLKLRGAKKAEIDQRVAQAAEILQLEHLLD 42 21 50%
3669 ALL-24-LVD ALLEDLVEDEVVAIELSGGLFGSAVAKLVD 62 3 5%
3670 LLG-28-LSL LLGTLLLGLDLLSRLLLGGLLSLLAGLLLLVLSL 80 13 16%
3671 VLL-28-IGA VLLAEAKVPYDIVLEMDEINDDFADTDVVLVIGA 61 32 52%
3672 LVL-29-LIA LVLLAQDFAALLLIKLEQNYRSSGRILIAANILIA 69 11 16%
3673 LDV-29-LAA LDVDLQGVDLLDLALLLASLGSFVGGPVHDLNLAA 67 14 21%
3674 LLL-26-EGL LLLDIGAALLLALLIKTELVAAKALDFKGEGL 53 4 8%
3675 LLG-25-LLR LLGAAALGDIGKLFPATDPAGKGADSRALLR 73 15 21%
3676 LLV-27-LVI LLVDACYSPVERIAYNVEAARVEQRTDLDKLVI 52 15 29%
3677 GLG-24-LGF GLGNSIQKLAYLPEAHTDFIFAVLGEELGF 47 22 47%
3678 LSA-26-IAA LSAVAALLLASLLGAALLLTIGTLLFTTLIAA 69 9 13%
3679 VLV-25-LGT VLVFLVMYLFLQNVRATLIPTIAVPVVLLGT 45 18 40%
3680 LVA-27-ITL LVAFAAATGVMPLDMPESVLVRFKGKMQPGITL 45 19 42%
3681 VVL-27-VLT VVLMDIRMPKVDGVEATIRILAAIPGVKVIVLT 45 17 38%
3682 IAA-25-ALV IAAGAGAELLAALVGPDDILIAALALTAALV 78 8 10%
3683 AAI-29-ELA AAIEAQLESAVLRSYEELAFSGGDGQLKDGDEELA 62 4 6%
3685 GIA-28-ELA GIAIYDDEGLLLPVVKYADVKLHADYGDEIPELA 51 20 39%
3686 IAV-24-ADL IAVSLVLAAASVATLIARTVANGGSKVADL 44 6 14%
3687 VAI-25-AEI VAIARALILNPRILLADEPTSALDVSIQAEI 36 19 53%
3688 FLA-25-EVL FLAAIDATDKYFNDLDAVEGDIVKGDGDEVL 36 6 17%
3689 VID-25-GLG VIDNGTGEPMGDLTKLGQPFMTTKGGGTGLG 38 21 55%
3690 DVL-26-GLS DVLVATTIIETGVDIPNANTLIVEDADRMGLS 44 27 61%
3691 NLL-28-ELL NLLSSRTVFGNVALPLELAGTPKAEIKRRVTELL 51 29 57%
3692 ATL-25-LGT ATLLSAMTGIARFVQDKALKKILRETDGLGT 42 12 29%
3693 ISA-29-VLA ISAARAFEIEQLLALRLIIPVPHDDQHGTAAVVLA 49 10 20%
3694 IVV-29-LVG IVVVENVERVMAEEGLPPKEATRKSMGQIQGALVG 40 27 68%
3695 LLG-25-SAL LLGGAVGTSAALALLFALAAAMAGPAPLSAL 79 11 14%
3696 LLK-28-LAA LLKILLYLYLIVIRLLAKLAEMTLTDAAFLYLAA 69 11 16%
3697 AVL-24-LAI AVLFIVAVGLLAIPLALSLTPLVGEAVLAI 65 7 11%
3698 ELV-27-ITL ELVLVDGKWTYTLDQSQAQQLDEGEKVQDTITL 34 14 41%
3699 LDA-27-LDA LDAFGAVTDAAGLAAEDAALAKEVRASTDALDA 62 10 16%
3700 IGV-29-LIV IGVIFFPGSFQSRARALGIMQGILGLILLVPELIV 39 8 21%
3701 LLA-27-SLV LLASKALLRFVALHATLVVLCLSFLLMIALSLV 69 11 16%
3702 LSL-25-IGL LSLGGRMRLDLAAGLLHNLKTLLLDEPTIGL 63 14 22%
3703 ELL-29-GLL ELLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLL 65 13 20%
3704 LLI-29-VLV LLIDSLLTLGLDDGAIEYIFKRLILERLLGLAVLV 56 8 14%
3705 ALS-29-IGL ALSAGASDMSGWLLMGLPGAVYLSGLSESWIAIGL 58 23 40%
3706 LSA-28-AGL LSALPLVLLLFGSGDEILAGALYNGLRNLAAAGL 78 7 9%
3707 VLV-29-TLA VLVGFLGLAGFMGVSKKLETAIGLGAATTFGLTLA 56 10 18%
3708 VSL-26-GIV VSLIGTFAEIVALGFSNNAGKLFGLVLAIGIV 42 16 38%
3709 RLL-25-IVD RLLGSVGEPINPEAWDWYYEVVGGERCPIVD 37 22 59%
3710 AIS-24-GLL AISHAVLPGVALSFILGINFFIGAIIFGLL 51 10 20%
3711 EAL-24-TLL EALRDINFLVEEGEFVAIIGPSGSGKSTLL 57 24 42%
3712 SAL-29-SLL SALGALGALALTLANSTLLVGIVLNTGGGAGFSLL 63 13 21%
3713 LLK-25-GAS LLKSSKVAVEADESATTGEFVAMLAESKGAS 37 5 14%
3714 KLA-24-ISG KLATWYSEMKRNIERFEHAAAGVEAGKISG 35 13 37%
3715 EIL-26-LSG EILKKTGATVGVLDALFEVYEGEIFVIMGLSG 45 14 31%
3716 IGA-27-ILA IGAGGLGREVLLGIQHVDIGVGFVGGLALVILA 63 17 27%
3717 ATL-29-VGK ATLKKYFDGSVIPENPRITNAQKAIRTNDIENVGK 35 13 37%
3718 TGL-26-DLI TGLNRPIAYVPLAVKGLAEVTGLYCVPAEDLI 35 10 29%
3719 LID-24-AIE LIDTAGVRKRGKITEAVEKFSVIRTLQAIE 38 18 47%
3720 VID-24-LLG VIDASHAEGKWTGMCGELAGDERATLLLLG 40 19 48%
3721 GSI-28-LLD GSIRIHRRELQEAVFEVLGITEEEAQEKFGFLLD 36 19 53%
3722 DLL-24-LVE DLLVKNNTRVIPARIFGRKASGEKLEVLVE 49 12 24%
3723 DAL-29-ITA DALKRASAGSINVAIPYYGYARQDRKARSREPITA 43 14 33%
3724 VLL-26-VLI VLLALLATGLFVAIAALSGNLLGLAEGILVLI 58 6 10%
3725 LGV-25-SLV LGVALLNINLGHNFLQSALYGFLAAVGFSLV 50 12 24%
3726 AVL-27-LLT AVLLTVVLLGLAADLVSQLRVSAIFAALLLLLT 68 6 9%
3727 SLA-28-ALN SLAQLIIPAADLSEQISLAGTEASGTSNMKFALN 42 16 38%
3728 LAA-25-GIS LAAQFNRPGHDIVDHFTYVFMGDGCLMEGIS 56 24 43%
3729 GIG-29-GGG GIGGSATNDGGAGMAQALGAKLLDANGLDIGFGGG 47 18 38%
3730 GIG-25-VLI GIGLAATQVDIHQRIIVIDVSENRDERLVLI 48 16 33%
3731 LIA-28-ALV LIAVEVTTALDASIQALIILLLLELQAILGAALV 71 15 21%
3732 IAL-27-AAI IALGAVAQATAVIGIIGISEKLIATAIGLLAAI 65 18 28%
3733 LLV-26-VLE LLVLGEVSLLLASGDAFLEFRRAVLKLLEVLE 49 7 14%
3734 LLD-26-ITA LLDEYLPDGDGLELLKLIREVKPGVDVIGITA 37 13 35%
3735 GLG-24-ELL GLGSSACSIVANLVALNQFFDLPLSKPELL 55 10 18%
3736 LDL-24-IVS LDLRMPGGTGLSGLIALRALFPELPVVIVS 35 10 29%
3737 TLA-27-GGG TLAADLLPLTRLSASVGEEELGKRARGAEGGGG 52 8 15%
3738 DVL-27-ALT DVLLAISTSGNSGEIVKAVEAAVERGMAIVALT 48 18 38%
3739 IEA-28-AKL IEAGTYMIAAAATGGGVKIDNVIPEHLESFIAKL 37 29 78%
3740 EVI-25-VLI EVISADYEKEYGKDVLTMHKDAIKPGQRVLI 34 15 44%
3741 FGL-29-GLV FGLPIVLNPVIAIPFGLVPAVLGIVAYPAMLIGLV 45 12 27%
3742 IVD-24-DLI IVDKKTPMLEAFSEADNVLRQGVQGISDLI 35 23 66%
3743 LLG-29-GID LLGQNVNAYRGETVDGLTCSFADLLRLVAAIDGID 43 16 37%
3744 LLG-24-IVD LLGSVGEPINPEAWEWYYEVVGGERCPIVD 38 22 58%
3745 AIA-29-IAG AIAEGLALRIVNGDVPESLKDKALQALDMGALIAG 60 18 30%
3746 GLS-29-LLF GLSPAISIEQKSTSHNPRSTVGTVTEIYDYLRLLF 47 32 68%
3747 IAA-26-VLN IAAVVLGGTSLSGGVGTIIGTIIGALIIGVLN 39 16 41%
3748 DVL-28-LVE DVLEEVIAEHPVLLNRAPTLHRLGIQAFEPTLVE 48 23 48%
3749 LAT-27-GID LATNGDTHLGGEDFDQRLIDYLVDEFKKEQGID 37 29 78%
3750 GVG-25-GVG GVGVGVGVGVGVGVGVGVGVGVGVGVGVGVG 77 36 47%
3751 VEL-26-LEL VELVKITKPEDSMAALEKLTGHAEEVLQALEL 41 21 51%
3752 IVV-26-IVA IVVEHDEDTMRAADYLVDIGPGAGEHGGEIVA 37 19 51%
3753 GAS-28-VVL GASFALMFAGVPIKLAFAGVLMSLVAFSIPIVVL 45 24 53%
3754 LGA-26-VSV LGATIDLEEGYVKASVAGRLKGAHIVMDKVSV 46 21 46%
3755 VGL-24-ATL VGLHFSLLDLMAVKAIAIPGALAQIAVATL 52 13 25%
3756 IAG-27-GFL IAGDYMSAASFLGISALVFTSGYDGLIYSIGFL 40 19 48%
3757 IGA-27-SGI IGADADAIDKAEDRVRFVYAMKKIVLRVAVSGI 39 20 51%
3758 IVS-25-LVG IVSIEDGLDESDWDGFAYQTKVLGDKIQLVG 39 21 54%
3759 LLG-26-FLL LLGYLDSLSKKNLNEVLRGEDNIVLSEVRFLL 61 15 25%
3761 LTG-25-LTL LTGLALTAVLDLLAVLTVLAVGRRASSVLTL 52 6 12%
3762 IGA-29-ALG IGAGMSDGIGFAANARTALITRGLAEMSRLGAALG 65 11 17%
3763 VLD-26-TLI VLDEPSIGLHQRDNDRLIETLKRLRDLGNTLI 35 28 80%
3764 ELI-25-LLF ELIGITAGESEDPEKNIPKAINQVFWRILLF 41 26 63%
3765 GAI-24-IAL GAIVGTNGGELLGEIGLAIEMGCDAEDIAL 47 11 23%
3766 IGV-28-ILV IGVILQFLIMPFLAGLLTSIFTLPAEIAVGVILV 40 13 33%
3767 LDG-26-GGI LDGALVGGDLNISSDEAIHKALYKPVQVGGGI 35 12 34%
3768 AGI-27-GDL AGIAEDVRVSELTEDQEDAIRDEVAKFKVEGDL 39 18 46%
3769 VIG-27-LEA VIGAETLSHILDWEDRSTAVLFGDGAGGVLLEA 43 16 37%
3770 GAG-24-TLG GAGPAGYSAAFRCADLGLGTVIVERYETLG 50 15 30%
3771 GSL-29-LTL GSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTL 52 26 50%
3772 SGI-29-LGL SGIGIAEEALKRLFEAFAQADGSTSRRYGGTGLGL 48 24 50%
3773 GFL-27-IAA GFLGALAGLIITSRLLSAAITAGGSGELDAIAA 44 7 16%
3774 LAA-24-AIE LAACLGALAVVDADQGVEAQTLANGYLAIE 61 13 21%
3775 LLD-24-LGL LLDEPLGALDKKIRLEALEELRALLRALGL 65 10 15%
3776 GGI-26-AFL GGIAVTNEILQLLLRQGARLAEPGEFTKRAFL 40 21 53%
3777 GGS-28-TLG GGSANKAYLYQETKALLTPGKLKNFLVEKMLTLG 37 15 41%
3778 IAA-24-EVI IAAEDILHDIGAFSMDSSDSQAMGRVGEVI 40 16 40%
3779 LLT-25-IGL LLTDGRFSGGTSGLSIGHASPEAAAGGAIGL 51 14 27%
3780 VLG-27-TLA VLGVPVQSAALSGVDSLLSIVQMPRGIPVGTLA 58 20 34%
3781 LGG-27-IGA LGGTIGVGATAPLSSMILTALLGLTGLAMAIGA 61 11 18%
3782 ILG-28-ALE ILGSGVFGVASALYLEIAGGEVTVIDREPEAALE 44 8 18%
3783 AGI-29-AVL AGIVVLLLLTIVAVSDVIAIGDAVIALGGLGLAVL 60 2 3%
3784 VLE-25-VIE VLEGMIAELRPYGGVGYDGLILTEDGPEVIE 36 8 22%
3785 SGL-29-GIT SGLPHNELAAQIARQAKVLNSDENFAVVFAAMGIT 35 19 54%
3786 IEA-29-ALG IEANEAFAAQALAVGKDLEFDEEKVNVNGGAIALG 47 19 40%
3787 DLI-24-ELG DLITISGYDGGTGASPLSSVKYAGCPWELG 39 18 46%
3788 DIL-29-LEA DILEATKQFVGLRAVKGKCLFVDGSVVPILLGLEA 40 10 25%
3789 AGL-24-SLL AGLALALLAFEEGARVFLALGAAELAGSLL 76 5 7%
3790 LVA-29-SAL LVAAAAVLGTEHYHEKLVTLAAATMIAREIIISAL 65 9 14%
3791 IVL-27-LAL IVLGIMALPTIVAISLRRRLALPNLFVSGALAL 63 4 6%
3792 DLL-26-LLP DLLALGLAGEALNLGYLIEQGLVIPIGDPLLP 50 12 24%
3793 GAL-28-SGL GALGGSVAGALSVRLGGGEVTLGSLVLLAIASGL 53 7 13%
3794 ILV-26-ILL ILVPFAATLAVPDLLGSVVGKILSGLLLGILL 52 10 19%
3795 IEA-24-LAT IEAATEDLEIKRKVFAQLDEVLPPEAILAT 46 22 48%
3796 GIS-26-EIV GISREEQDAYALSSQQKARAAIDAGRFKDEIV 35 20 57%
3797 FGL-27-ISG FGLKLALWYSEMKRNIERFEHAAAGVEAGKISG 36 20 56%
3798 ALA-29-LAK ALAMEPDVMLFDEPTSALDPEMVGEVLAVMKDLAK 81 28 35%
3799 ALG-27-LLS ALGGGVIGDLTGFAAACYQRGVRFIQVPTTLLS 79 22 28%
3800 LGV-28-AIA LGVLSAAAGGLLSTAQAFVLAGNAARALGLKAIA 75 6 8%
3801 LSA-24-ALT LSAALAVLLARLYIGGDGTVLPLGGDGALT 63 1 2%
3802 LGA-24-VVI LGADIVAVAAIGDLALGVLLVPGSGADVVI 49 1 2%
3803 LVG-25-DAL LVGAGPGDAGLLTLRALRLLGEADVILYDAL 57 19 33%
3804 VGL-25-AIE VGLAGGAGILIVEFALELLDKTLEVVDEAIE 36 9 25%
3805 GIA-27-IVS GIAMVLSAVFIPMAFFGGSTGAIYRQFSITIVS 38 20 53%
3806 EIL-25-AIG EILPKFVFKGFVILLLTEFGGNILLIFVAIG 36 11 31%
3807 NAL-24-ALV NALHRPKRFFGAARNVEEGGSLTIIATALV 46 19 41%
3808 VIE-26-LAS VIEKVSEIAIVLEEAERLNVEPRLGVRARLAS 38 14 37%
3809 VLV-29-IVL VLVLLAALLGLLGKIRDESKFILKKLACLGMGIVL 48 9 19%
3810 LTG-26-AGI LTGIYTSDAGLILRQGKAITFKGPKEIQEAGI 49 10 20%
3811 TLA-27-LVD TLAAVFLIMLATGANFDRITLGALILALGLLVD 47 10 21%
3812 TLA-26-GAI TLAALIGAGGLGSFILLGIDRNNASLILIGAI 44 17 39%
3813 IAD-27-ELG IADQARTIRIPVHMVETINKLLREQRNLLQELG 38 18 47%
3814 LDI-26-LIG LDIPGKPWDTPQLAAELERWKDDGRDVSLLIG 36 12 33%
3815 IPL-26-ALG IPLVLAITFGYMEYLGISLQRISLGALIIALG 49 17 35%
3816 DVI-28-VSG DVIEVEGTVVETLPNAMFKVELENGHQILAHVSG 32 21 66%
3817 LSG-26-ALG LSGGQRQLVAIARALLFGAKVLILDEPTAALG 69 23 33%
3819 LAI-24-LGL LAIASALAGKLAQALLLILIGTALGIVLGL 78 6 8%
3820 VLS-25-LGI VLSGGPGSVLLAGAFGIAVIIFLLGAPILGI 51 9 18%
3821 VIG-27-IGG VIGGGPAGLAAADRLARAGVSVVVFERNDEIGG 45 28 62%
3822 VLI-27-IGV VLIIDEVTAALGFELGIEKLGLIVGIIILGIGV 38 9 24%
3823 IGA-24-LSA IGALLAQNFRGLENDVYFQVGLLLKIGLSA 53 16 30%
3824 LVD-24-ITL LVDGKWTYTLDQSQAQQLDEGEKVQDTITL 41 14 34%
3825 TIA-26-VSL TIALYGEFGSGKSTLLAILAGLDLGSSGEVSL 34 7 21%
3826 LAS-28-SIA LASHREFTSWRAELDGKPVIVCSTGIGGPSTSIA 41 12 29%
3827 SLG-26-SGG SLGEVAGEKIVRAIELALEAGAPVIGLNDSGG 39 18 46%
3828 IGS-27-SLA IGSALVRIIIAETVVAVVNVDKLTYAGNLKSLA 39 10 26%
3829 LLV-25-SLG LLVALTRYEDGDGKKESKNDPELGKLWASLG 64 13 20%
3830 SLA-27-LLS SLALFALRGIPPLAAGLAHIRVTFQVDADGLLS 72 16 22%
3831 ILG-28-NAL ILGYIAEDGECLVEKITGEAKTKTTVKSLGLNAL 36 14 39%
3832 ISG-25-SLV ISGDTVRYGRIINRGCHSIRRVIVQAAWSLV 37 19 51%
3833 VVI-24-VIV VVILAEAQNVTAAQMKMFLTRLGENVTVIV 35 8 23%
3834 LLL-27-TGL LLLSLLGLLTIGLLALLISTLFTAVSAGNVTGL 64 7 11%
3835 ALA-29-LDV ALALEKRLYEELADLLLPHLAALQAAAAALAELDV 73 21 29%
3836 TLL-25-LAS TLLADDKKISERTKEALPVAQTRGVGVVLAS 58 12 21%
3837 ALG-27-VEL ALGLSLPGNGSLLATHADRKQLFLRAGRRIVEL 52 21 40%
3838 LGV-27-ILA LGVAAGDGAIFLLFIFALFPAILALASGSAILA 61 7 11%
3839 GLG-29-LAT GLGTADMKGFFAFILDAVADVDAAKVKKPLYILAT 60 16 27%
3840 VAL-26-AIE VALGNTHEDNWEWHMYDTVKGSDYIGDQDAIE 43 12 28%
3841 EIA-29-LFG EIAIPMIESLARALSAMFILLADGFPQPFLTGLFG 33 12 36%
3842 SGG-24-GGG SGGGGGPGGQKGGGGGGGGSGGGGGGGGGG 94 23 24%
3843 LLN-27-ALA LLNRVLIVAPAIAALHQLLGGEDGTVAAARALA 59 7 12%
3844 LGS-24-LLG LGSLVLILLALLFAFVLNYAPGKEILGLLG 59 9 15%
3845 LGS-29-IGG LGSARFPEFRDENIREVAIENLKKRGIDALVVIGG 40 15 38%
3846 VGI-28-SGL VGIDDMVIPAKKFEIISEAEAEVAEIQEQFQSGL 40 17 43%
3847 GGS-27-ASG GGSMGSVVGERFVRAVERALEDNCPLVCFSASG 50 32 64%
3848 ALN-24-LLS ALNNIDGDIAARVELGAKDGDLDGASSLLS 43 12 28%
3849 LLL-26-GIS LLLSHLLSLLEAAVIGNSEAIKLALALGLGIS 55 8 15%
3850 LIG-26-GVG LIGREKELERTIQVLCRRRKNNPLLVGEAGVG 46 26 57%
3851 GLV-25-LID GLVGHSGSGKSTLLNKLSRLYDVDIGKILID 39 11 28%
3853 GVI-24-LAL GVIRAKLRALTRLGILGVIEIGLGLILLAL 60 8 13%
3854 AFL-26-LAA AFLQQILLRPAEYDVIAVMNLNGAYISDALAA 69 14 20%
3855 NAL-24-ALI NALHRPKRFFGAARNIEEGGSLTIIATALI 40 24 60%
3856 VFL-26-SLL VFLPLFLVGGGIGELFRPFALTISAALLASLL 47 17 36%
3857 LGA-26-IAA LGAGGAPMGRIVEIIGPESSGKTTLTLQAIAA 73 11 15%
3858 LIE-29-IVS LIEQAEQGVDYFTIHAGVLLRYIPLTAKRVTGIVS 34 25 74%
3859 AAI-29-LGA AAISLGVGGIGVMNIMLGSVMARTAEAGLLKALGA 69 11 16%
3860 GIA-24-LVA GIALPQVANGAVVAPGIAEALAATAAGLVA 64 9 14%
3861 IAL-29-GAG IALGGLALIALGVRGALAALLKRELLLAVLAAGAG 57 8 14%
3862 AIA-26-GSL AIAEGLAWRIVAGDVPEVLADATLYSLDIGSL 58 17 29%
3863 AIA-27-IEA AIALRLALPGEALAEAYARGDAAALALRRVIEA 48 3 6%
3864 LEA-26-IAD LEAMTAVCSVGLDMIAIPGDTPAETISGIIAD 39 19 49%
3865 VAI-28-LVL VAIGAAHGMYAATPKLDFARLAEIRQAVAVPLVL 55 21 38%
3866 SLL-25-AKL SLLLRRPPGREAYPGDVFYLHSRLLERAAKL 43 38 88%
3867 VLL-28-LGV VLLAAQAGALSALKATALLAPVANTPAAAALLGV 73 12 16%
3868 IAL-26-IAL IALLGALKLKELSYVLAEGPLAGELAHGVIAL 67 8 12%
3870 GAI-28-SAL GAILLALGGEIEAARAYGALTAKGYGIIILPSAL 47 17 36%
3871 TGL-25-LGL TGLSAVPTAPVYTPGGQAIALLLIQGGGLGL 57 13 23%
3872 GLL-24-AIL GLLGYLLGATLILLLGVSVLSLLLTLVAIL 68 6 9%
3873 VLA-26-LLV VLAGTFAVMAYLGILLQRISLGALIIALGLLV 82 16 20%
3874 DAL-29-GLL DALGKLSLNDASLFYEPETSSALGFGFRCGFLGLL 60 31 52%
3875 LLS-24-LGF LLSQLFGSLVNAAKLGALLDLIVAAFLLGF 48 6 13%
3876 ILL-26-LAT ILLALGAILVDELAVVLTGGLKMNVRGAALAT 51 6 12%
3877 VIA-25-ILV VIADSGLKILIVAKDDLSQAENLAIASVILV 40 15 38%
3878 LEA-28-LLS LEAKGLLGARQGGGTFVIILALASFATALVRLLS 50 14 28%
3879 LLP-28-GVS LLPLDDLLVLARTFLNPNLSRSALDRCLRAHGVS 41 12 29%
3880 DLA-27-IAA DLAQLIADLKQVNPLARVSVKLVAEAGVGTIAA 59 17 29%
3881 GAI-24-LPL GAIDALKRIGQVSDLNLTAVLFPGAIELPL 43 9 21%
3882 ILD-28-AIA ILDEATSALDSETEAAIQESLAKLMQGRTVIAIA 40 21 53%
3883 VSG-28-AIA VSGDAFGAASGGLAKIGGSFPAAIAVEMEATAIA 49 12 24%
3884 GVS-25-LGL GVSLLALAMPSSALVDTYLSFGLGKLTNLGL 61 15 25%
3885 VSV-26-ELV VSVATTFKVELADAGIIFCSCAEAIDNHPELV 36 11 31%
3886 SLL-28-ALI SLLLLLGLEAAALVLILILSGGVLQRTALADALI 68 6 9%
3887 LLI-27-LLV LLILDEPTLDLDAETLELLEELLDAYLGTVLLV 69 14 20%
3888 DAL-26-GDL DALLEISRKGLGMTAIVDESMLLAGIFTDGDL 46 14 30%
3889 GIA-29-LLL GIARALALNPAILLADEPTSALDVSTQAQILNLLL 79 31 39%
3890 SIA-29-VGL SIADVLDMTVEEAAEFFEAVPAIRRKLDTLVEVGL 43 21 49%
3891 GLF-25-SAL GLFFFGWDRLSKVQHLLVTWLVALGSNLSAL 40 22 55%
3892 VLF-29-ALA VLFAPARALFGGLLFGLLLGLLAAPVALYVLRALA 57 16 28%
3894 GIL-27-GIL GILGALALLVLRFGGLITINASLLLVGIFLGIL 47 6 13%
3895 ATL-24-DAL ATLNQALIKDKRGENLAILPASQTRDKDAL 56 18 32%
3896 ILD-27-VLS ILDPEDARDAVRFGADGIVVSNHGGRQLDGVLS 38 14 37%
3897 VVS-29-EVL VVSGLVMAFQFGTNWSEGSRTTGSVTGPLLTYEVL 40 15 38%
3898 NAL-26-SLA NALSPAKVLKVIVDEEEEATEVVVPDYQLSLA 41 20 49%
3899 GGS-29-IGA GGSTRVPLVRELVGEFFGKEPLTSINPDEVVAIGA 40 26 65%
3900 FLG-24-SVV FLGLLHMEIIQERLEREFNLDLIATAPSVV 31 17 55%
3901 LLL-28-AFL LLLFGFTLLLLGIRSKMLLSLLFCGAAAFLSAFL 69 15 22%
3902 LLS-26-RIL LLSIVQMPAGVPVATVAIGGAKNAALLAERIL 53 15 28%
3903 ELL-24-SLA ELLEEEALGDDQRGSTLRRLDLGVCRDSLA 58 15 26%
3904 LVL-29-ILG LVLKGDEVAVLSVLLGLSLLIGLGISGAQIAIILG 54 5 9%
3905 ILL-28-LVL ILLALLGKLALLLVRLLGTLLVVAGLAVALALVL 65 9 14%
3906 RLL-29-IDL RLLKVLPRLVDLGHTVLVIEHNLDVIKTADHIIDL 42 16 38%
3907 IVL-24-LLA IVLGILYESYIHPLTILSTLPSAGVGALLA 67 25 37%
3908 VGL-24-LGI VGLEMSGAPSAFRFMLDTMNHGGRIAMLGI 53 16 30%
3909 VIG-28-GGS VIGGGTGLPVILKGLRLEDVDITAIVTVADDGGS 40 12 30%
3910 SGG-29-GLV SGGSAAAVAEPDFPLALGLDAVGSIRTPGAKYGLV 48 16 33%
3911 VVI-25-IVL VVIENIANLYRSILAKGIDDIAALGKYNIVL 37 8 22%
3912 FLA-24-LGL FLAGVLLAESEYRHELEADIEPFKGLLLGL 56 24 43%
3913 AIT-26-ILL AITAQILKAKLPTHVEIQAKGYGLDKDSVILL 38 11 29%
3914 LVA-29-IVG LVAGLVGGLAVALLLAALVLAIAGAAAVVVSLIVG 57 15 26%
3915 EAI-24-ALK EAISKARRLMEEEGILAITSSGAAVAEALK 45 8 18%
3916 LLG-25-VLG LLGPNGAGKTTTIRLLLGLLAPTSGRVLVLG 79 30 38%
3917 SAL-26-ILD SALAEKGIEIGDRKIDRLELALRPKDGKGILD 38 9 24%
3918 AGL-29-RLL AGLDLATAGRLLVGTAPLAEALRDARLMFQDARLL 81 11 14%
3919 GAL-29-IGL GALIEAAAVLGAAAAGAKLGAGLPVLVLGAGPIGL 58 22 38%
3920 ELA-28-SLA ELAEQLIEQTGDNTLTLMDKGYYSLGLLNGWSLA 56 18 32%
3921 GLG-27-IGL GLGAIWAFPTVAGISGGGAFLLILGGPALLIGL 57 12 21%
3922 IGL-24-LVG IGLGLGIVRQKLALLRISIILSSLFGALVG 59 9 15%
3923 VLV-26-VAI VLVVAADDGVKPQTILAILHAKAALVPIQVAI 48 14 29%
3924 LVG-25-VLG LVGANGAGKLTLLRLLLGLERATAGVVSVLG 63 17 27%
3925 IAA-29-LVL IAALAAAAAAGSYALAAAPLAIVILVALDAVGLVL 70 1 1%
3926 SVL-29-LLA SVLARLIAGAKAFENAMTLDIAMGGSTNTLLHLLA 74 13 18%
3927 LTG-26-AGL LTGYGRGEGAVLLAAAEVEGAQAATRLGLAGL 75 10 13%
3928 GIV-28-LAL GIVLGLVIIPGVAATAERAALALSAAPGLSALAL 61 2 3%
3929 ATL-28-ALG ATLVMGDAIAVALLLARGFAAEDFALSAPGGALG 69 11 16%
3930 GGI-29-LAS GGIAVDVNGRTSIPGLYAIGEVACTGLHGANRLAS 43 25 58%
3931 IVS-28-ALL IVSAVMVALEQCPPELASDISERGMVLTGGGALL 54 19 35%
3932 LLL-27-VGL LLLSLGTAVLAGLLASLLLKVLAAGLLLLVVGL 86 6 7%
3933 LIG-29-LAL LIGLLLLGLLLLLGGLLIDMALLAGGGAVSLLLAL 84 9 11%
3934 ELA-29-LSG ELAAEIGNDALDATTVLNAVGLGHRLDNFPAQLSG 56 24 43%
3935 AGL-28-VIG AGLAGALLAARLGAAAAIAGLGLELDAIAAVVIG 61 21 34%
3936 GIG-29-ALL GIGILFLAAVLPGGPLILGRVAAGVDRLSTALALL 66 6 9%
3937 GIG-29-ALG GIGLATAAAAHGLALIFTAPGKFSGEKLGLGRALG 67 23 34%
3938 EIA-25-IAA EIAMEHNLGLTCDPVAGQVQVPCIERNAIAA 47 11 23%
3939 GIV-27-GLG GIVQGTYETFVEGGRQHYIGNLKGKWVLTGGLG 54 22 41%
3940 NLL-26-ALV NLLGLKEPLNELDLVQRLALLIALLEALGALV 44 11 25%
3941 DLV-25-IVA DLVLLVAAIEGLEPTLPNAEAIGTDRARIVA 36 5 14%
3942 ISG-27-AIA ISGYMLESALEAGLVAAGALGALLGPMPTAAIA 46 9 20%
3943 GLD-27-LTI GLDYLVQIAEKLLRRNPKYISILAPIVTYFLTI 31 16 52%
3944 AEI-26-AIV AEILGLTELLDRKPKALSGGQRQRVAMGRAIV 36 19 53%
3945 IVV-25-ILA IVVNGADGPYEPVADVTLLLLIVLELLDILA 40 2 5%
3946 VIE-29-SLV VIENLLEKADKVLIGGGMTYTFYKAQGIEIGNSLV 36 18 50%
3947 NVL-29-NVL NVLERRQRDAENRSQGNVLERRQRDAENKSQGNVL 30 15 50%
3948 ALS-25-GLA ALSIALLPGVAGLLEFGLGNLAAFALLAGLA 74 7 9%
3949 LTL-25-LLV LTLLLGLKGIGLLSLLPALLIAALGRGGLLV 65 2 3%
3950 GAL-28-TLA GALALAYADALGILPYLLRGIIAQLLTAIMPTLA 67 13 19%
3951 VEL-26-LIG VELPNALPVIMAGIRTAMVLIVGTATLAALIG 38 16 42%
3952 LGL-26-VLV LGLAGIVLGTTLLGITGLWLALLADLGALVLV 93 11 12%
3953 ILA-27-LLR ILAEQLDAFVDLRDVRQPEVKEEKPEFDPILLR 52 14 27%
3954 AIA-25-LIA AIAALLLFANAANAEEKLFSAYLEGAVQLIA 72 8 11%
3955 GLS-24-ALI GLSGYNLTVAIDDPAVAEIVDIEYPSWALI 53 14 26%
3956 VLI-26-IAL VLINGESGTGKELVAHALHRHSPRAKAPFIAL 51 16 31%
3957 EIA-26-AAL EIARALGAAALAHDATGKGLVTVVAAPSLAAL 67 4 6%
3958 EIV-29-DLA EIVLHSLQDLKCSAIRIANGEHTGRGIGSPITDLA 36 11 31%
3959 GIE-26-LLV GIENYSRFLSGRGPGEPPPTLFDYLPADFLLV 36 21 58%
3960 VGK-29-VLG VGKGPTFDTGGLRLKLITGGFVKILDDGGAARVLG 35 18 51%
3961 ALI-25-LIG ALILSLIGVAGSHGTRVGQKVIGLVMLALIG 65 9 14%
3962 ALE-27-ALV ALELAGLALRATRKPAQLSGGQGQRVAIARALV 71 19 27%
3963 SAL-26-GAL SALGRSGLNIENYENFIQTDAAINRGNSGGAL 68 31 46%
3964 ALT-25-TLA ALTGLTMAEKFRDEGRDVLLFVDNIYRYTLA 59 19 32%
3965 ELA-25-LGG ELALIREALRLAKPLLAVLNGLALGVVALGG 53 12 23%
3966 LGG-26-LIA LGGGIDEREQTLNQLLVFMDGFMANPGYILIA 57 15 26%
3967 DLA-29-IEA DLARYRADGVLEYVGRIDHQVKIRGFRIELGEIEA 42 21 50%
3968 LAT-28-VIA LATAELLLAALAAMGPLRIILDLITMALLAVVIA 48 12 25%
3969 ALL-27-AIL ALLATTLRGLENDVYFQVGLLTTIGLSAKNAIL 82 30 37%
3970 LSL-28-LGV LSLKELEFISRAIRAGGAVSLISGLVIVGIALGV 67 10 15%
3971 LLD-27-VLT LLDLNLPKVDGRELLAVIKLDGDLKRIPVVVLT 46 15 33%
3972 GLV-24-VLF GLVGESGQGRSGVGRRIILREKGTSGDVLF 40 22 55%
3973 LVV-29-LAL LVVAATLLLLIGLLLALLGLGLALLLVAILLALAL 82 8 10%
3974 EIL-24-TLL EILKDISLEIEKGEFIAILGPNGSGKSTLL 46 29 63%
3975 AIG-28-LIG AIGGGIGTGLFVASGAAISIAGPGGALLSTGLIG 57 10 18%
3976 LLP-27-EVL LLPKKTVFENVAFAMEVIGEKPRVIKKRVLEVL 45 14 31%
3977 AIS-28-VIG AISLLVVFLCLAALYESWSGPFSVMLVLPLGVIG 38 14 37%
3978 GGS-24-TLL GGSTNDATPTLAGTAEANSTISIFDGTTLL 39 21 54%
3979 IAT-24-LAA IATAAAFENAMALDIAMGGSTNTILHLLAA 59 14 24%
3980 NLA-24-VLD NLAIKGAAHFYQKKGKHIITSKTEHKAVLD 34 24 71%
3981 LIA-29-VIL LIADEPTTALVVEGQAPILELLEKFFRELPKAVIL 50 9 18%
3982 LTL-29-SGV LTLAAVHTLGIPVDLPTALLLSVVAALCACGASGV 39 20 51%
3983 ALK-28-VIA ALKYGTPPHAGLAFGLDRLVMLLTGTDNIRDVIA 50 26 52%
3985 AGI-25-EAL AGIVLLSIGAGGVFKGVLVDRGVGPALGEAL 56 6 11%
3986 ELV-26-LEA ELVTATRQFEKPEEDEDLMPLQAFLSHAALEA 45 16 36%
3987 IAS-27-ADL IASVFLESFLFYSGFWLPMYFSSAGKLTNTADL 38 10 26%
3988 DLV-29-IGA DLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGA 38 16 42%
3989 TGL-24-LTL TGLPLLLLSPLVALLLGMDVYTWGAMALTL 45 14 31%
3990 ALI-26-LLR ALISEGKIDVLIFFWDPLNAVLHDPDVKALLR 57 11 19%
3991 GLG-24-ELA GLGHGSSNAAAVLVALVGLGQIGLSKDELA 54 8 15%
3992 GLG-26-ADL GLGTASGGLADDAVVGASIVKAVPANGLAADL 57 6 11%
3993 GVL-27-GLG GVLIKSALLVVRAVALGADYDALVDTALLFGLG 61 10 16%
3994 EAI-26-GEL EAIRQLRNDLGRENAMYIHLTLVPYIPAAGEL 39 16 41%
3995 ADL-25-LLF ADLFKFDDSLRGRLKTALLTLAPPLVGGLLF 36 8 22%
3996 YLL-24-LGV YLLAGVLIGPFTLGFVADVDLALHLAELGV 39 21 54%
3997 GLF-29-LGV GLFSNEAGMGSAPNAAATADVSHPVKQGLIQTLGV 43 18 42%
3998 LSG-25-ADL LSGAALSGADLSGADLAGAELSGANLSGADL 61 21 34%
3999 GLS-28-LDL GLSDSGRSKDFFTGGRIGKEALYSGDYDAVILDL 44 6 14%
4000 ILG-29-LAE ILGHAHPKVGGAVGETAGLGDSFGAPTELEVELAE 47 19 40%
4001 IPL-29-LLV IPLVLAITFVAMEYSGISLQRISLGALIIALGLLV 43 17 40%
4002 VLL-27-AIL VLLALGLSLLAVYIGILGLLAILLRLGAVTAIL 68 7 10%
4003 LAK-28-RLI LAKALAASLFDSEDAMIRIDMSEYMEKHAVSRLI 36 22 61%
4004 GSG-28-LNA GSGGVVGDTLLANAAQSPGVEVSLGAVAARLLNA 36 7 19%
4005 EAI-27-LDI EAIQWVNIAFMAVCRVINGAATSLGRVPIVLDI 35 11 31%
4006 GIE-26-VIE GIEGVEKAIDKALEGKPPERGVRKGRQGRVIE 33 13 39%
4007 ALE-24-AGL ALEKAKELLGAAFLYALGVAEGGAATAAGL 65 6 9%
4008 ASL-24-LIA ASLANLLFALPGLEGVTALRLVLILLGLIA 65 6 9%
4009 KLA-26-VLS KLARKYHPDLNPGDKEAEIKFKEINEAYEVLS 42 16 38%
4010 ALS-24-GGG ALSTKYNDTPEKASRTYDALRDGFVIAGGG 52 15 29%
4011 LLK-26-VLV LLKELQKELGLSLLFIAHDLAVVAAISDRVLV 44 16 36%
4012 LEA-24-VAL LEALFLGVMLFGWDRVSPVLHFFATRMVAL 58 15 26%
4013 GAL-24-LID GALKLKEISYIHAEGYAAGELKHGPIALID 46 27 59%
4014 GAI-25-VIG GAIITGIDKPLGDIIGRIFCLALILDGAVIG 54 8 15%
4015 IPL-25-IAL IPLVLAITFLAMLYLGISLQRISLGALIIAL 47 15 32%
4017 ALE-28-IVG ALEPALQNVAITATDIPALVGFAQGEKIALTIVG 41 13 32%
4018 AIL-27-LDV AILINAARGAVVDEEALVKALKEGWIAGAGLDV 38 25 66%
4019 VAL-28-LGT VALLEIVSKVDLASALIAIAGATALAMIIDYLGT 47 6 13%
4020 LVA-28-ISA LVAIALPLVFEHYHSIWVTLPAATMIAAEIIISA 49 9 18%
4021 SGG-24-SGV SGGEGKRSELLQALLPEPKLGILDEPDSGV 38 9 24%
4022 VLD-27-LIA VLDGEALGAERGEDAPLTGAQGEALALSLELIA 44 7 16%
4023 VEL-27-NAL VELGAESYDVIARYNGKPAAGIAIKLAPGANAL 34 17 50%
4024 VSV-27-LGY VSVATVSRVLNKLPDVSPKTRDAVLAAVDRLGY 35 15 43%
4025 LDG-28-AKL LDGDNVRHGLNKDLGFSEEDRVENIRRIGEVAKL 36 20 56%
4026 VSG-26-LLA VSGAELGSANLSIGVKGLELDGGDAIGPALLA 64 10 16%
4027 LLE-25-GGG LLEPTRIYVKAALPLIKEELVHGIAHITGGG 46 28 61%
4028 IVG-27-LLD IVGFRGINRIGQFLLDNAVLGGSNADGKSSLLD 43 8 19%
4029 ILD-24-LDG ILDPEDARDAVRFGADGIVVSNHGGRQLDG 36 22 61%
4030 LAL-25-IGA LALISGQAPLITKAKASIAGFRGREGVLIGA 75 13 17%
4031 LAL-27-ALN LALYLAVTADPEVSLLVVPLHIPDVAQLVAALN 60 13 22%
4032 AAL-27-GIS AALAAGVILAVAACIIALLTTLPLAVAAVLGIS 56 7 13%
4033 LAA-27-VLD LAAWAYALALNNGDLAKAQDFVLALYKNVEVLD 69 16 23%
4034 GLA-28-DLA GLAGGPDVDLFDEPTSALDPEAVGEVDAVMKDLA 64 10 16%
4035 VIG-27-LVE VIGGTLVLSGIIEIKVTEVGKDTALANIIRLVE 42 13 31%
4036 LLR-24-AVL LLRSLRAALLRVRRRADALAAVLLLAFAVL 66 1 2%
4037 EGL-29-GAG EGLSKRFGGVEALDDVSLALRRGEVTGLLGPNGAG 41 28 68%
4038 ILD-24-GSL ILDIDRKVTETLRSAELPTDNFGVPLAGSL 34 17 50%
4039 GIE-29-SGI GIEFKEGSAEVKKVIDFLQEEFGAVKIRFPETSGI 31 13 42%
4040 GLA-27-NLA GLAIGALHIALSLSGIGSKIKLFAFMPPQANLA 47 18 38%
4041 RLL-26-LGF RLLDLVSPNALELPLRVLLVLDEADRMLDLGF 41 21 51%
4043 IAV-27-LGG IAVKTNDKRIDPVGACVGMRGARVQAVSTELGG 50 17 34%
4044 SGI-29-IGL SGIGFIILTLTGIREVIINLIPFELKLAVAAGIGL 40 12 30%
4045 VID-26-AGI VIDELADLLAADREKEEEPIRRGTQAALVAGI 35 12 34%
4046 AIT-28-DVL AITPKTKWLILNSPSNPTGAAYSEAELKALADVL 34 14 41%
4047 LLL-29-GVV LLLTLLGFDAGLSLVEAVDISDLIQALLLRGVGVV 72 10 14%
4048 LAL-28-EVL LALAKEAAAALNVLLDALSIGVAPAILAAAIEVL 64 10 16%
4049 LLV-26-LAS LLVDAVSARALTAAQIVESLREASAILLALAS 62 14 23%
4051 LLD-28-ILL LLDEPLGGLEPLKEEEGIDAIGARADVLPGDILL 49 11 22%
4052 GLG-27-VIA GLGGGHDEREQTLNQLLVEMDGFEGNEGVIVIA 52 24 46%
4053 ALK-27-AIA ALKTIFLSAEGFASAAFLEGSGGGKGAVARAIA 53 8 15%
4054 SLA-26-VVL SLALMDAGVPIKAAVAGIAMGLVKEGDDFVVL 56 18 32%
4055 ADL-24-LLK ADLTGANPTSIISVVIFAAFLGVAALKLLK 40 7 18%
4056 FGL-28-LLL FGLAGALFILGAFSAGGLALLGLAAASLGLALLL 70 6 9%
4057 LAL-27-VLF LALGRRSGMPIIRILCVLFIEIWRGVPLITVLF 56 17 30%
4058 ALS-26-LAI ALSPSLVLKVAVDELEKAATVVVPDYQLSLAI 63 14 22%
4059 AIA-25-DIL AIAVQADVEDADGVAAMLSGGKDSFGRLDIL 45 14 31%
4060 LAE-24-LVI LAEAKVPYDIVLEMDEINDDFADTDVVLVI 43 22 51%
4061 AIV-29-VLS AIVKAENIPRPLIAESFKLLAAEQGAREVGVTVLS 41 16 39%
4062 LTI-25-LSL LTIPVGKDSMSMKTRWQEANEELEVTSPLSL 44 10 23%
4063 LAE-28-LVL LAERIGTAIALKLAFGLPLPGGAIATAADVSLVL 63 8 13%
4064 ASL-25-TLA ASLAKIDVEGVNVTLIHSAVGAINESDVTLA 59 16 27%
4065 LVS-27-ALA LVSYAWAGFGAAFGPVVLFLLGGLGMLRLGALA 74 10 14%
4066 SGG-24-GDL SGGTSGLSIGHVSPEAAPGGLIGLEPDGDL 36 13 36%
4067 VLL-26-ALT VLLAISAGGNSRDIVDAVAAAVTRDMTAVALT 66 10 15%
4068 LIA-26-GIA LIATLALIANLVLIVGVMSLLPGAALLGLGIA 56 10 18%
4069 LLV-29-VAL LLVALALTLAGLALAAALAALAGAILALAAGTVAL 78 4 5%
4070 TLL-27-EAL TLLKCLFGIYVKDEGAILFLGKEIDFKSSAEAL 63 10 16%
4071 LSG-29-ISA LSGHVSAILGIASASPSTSGPASTVIGGEDAVISA 40 8 20%
4072 LAA-24-VLE LAAQALVRYSLELPHAYVDSNVAGTLNVLE 83 13 16%
4073 LVA-29-SVL LVALAILSALGLGAARVMLLLAQALADILVPGSVL 51 18 35%
4074 GGG-24-VGL GGGLELALAADIEVAASEAYLALVEAGVGL 56 20 36%
4075 KLA-28-AIA KLARELGAAVGAYELSGQGPSRLSGGQQQRVAIA 49 19 39%
4076 SLV-27-VIL SLVEDLVNRSIEPLKVALKDAGLSVSDIDDVIL 43 21 49%
4077 SLV-28-ILV SLVEDLVKRSIEPLKVALKDAGLSVSDIDDVILV 38 21 55%
4078 ILL-29-ELI ILLEGEKVDALSFIVHRDGAYAIGATISEKLKELI 42 19 45%
4079 LSA-24-LGL LSAGVSGVQDLIAVALLLAARLLIALHLGL 77 10 13%
4080 IGL-26-LLI IGLSGLITPSLDEMVHVAKEMERQGFDIPLLI 60 20 33%
4081 VVL-28-GLS VVLTAGTFLVGLIHIGAKRFPVGVVGRGARLGLS 54 10 19%
4082 VLI-29-LTL VLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTL 46 16 35%
4083 LLP-29-LID LLPADVVAAKARGDIHYHDLLYEPFEPMFDCNLID 40 18 45%
4084 LLF-28-LFG LLFSSITYGFAAIAMIKGLGVAVRTLLALTGLFG 47 10 21%
4085 IAV-24-DIL IAVQADVSDAADVAALIDATVDEFGGIDIL 32 11 34%
4086 VIV-24-AFL VIVFTDPDINGERIRKAIMFAVPTAFAAFL 36 8 22%
4087 TLG-29-LID TLGIIGGDPAFLVRLTQSILARLEQAGKKAVVLID 35 8 23%
4088 GID-25-GLA GIDNLIFITILVPFLPLDQRDGARGIGLGLA 44 14 32%
4089 LLE-25-LGI LLEQQRGTIIEMFLMFSGGALSRASIFALGI 53 8 15%
4090 ILL-25-VVL ILLVVDSMTGQEVVNVAAEFNGQLSITGVVL 56 10 18%
4091 AGL-26-VFL AGLTTFFAMSYILGVNPGFLSATGMPSNAVFL 41 9 22%
4092 IVL-26-VLS IVLIILLAVSIGTSGLITVGLTGVLGEAFVLS 43 8 19%
4093 SLV-27-ALI SLVSLVICTVMIGVAFRNAGFLLLAIAALAALI 47 6 13%
4094 GGS-25-ALT GGSAADAQHFAAELAGRFDTERPSLPAAALT 43 18 42%
4095 VGK-24-VIE VGKSSLLNNLLREDKAIVTDIAGTTRDVIE 30 20 67%
4096 LLS-27-IAL LLSALNIVVGLGVYAVLVALLQAFRGAALLIAL 77 14 18%
4097 ELL-24-LAE ELLAKLAGEGNDQRVLLFTGTEEGAATLAE 75 8 11%
4098 LIA-29-SLV LIAAGLVLVVIIELLARLPQALATILIAELLLSLV 51 6 12%
4099 ILA-25-NLA ILALNAAVEAARAGEQGRGFAVVAGEVRNLA 38 19 50%
4100 VAL-27-GSL VALGAVLKGLLSALALLNPEVAAALAGWAAGSL 56 13 23%
4101 LVV-25-AIG LVVLVMRMLAEMAVATPDTGSFSTYADKAIG 46 12 26%
4102 SVL-29-LLG SVLLGILLFFIAAELAELNIFALVLVSAVVLTLLG 60 6 10%
4103 SGL-26-VAL SGLFVGAVLGLAGYLGLFDFAAALALGQLVAL 58 9 16%
4104 IVV-28-GVV IVVSRRTGLELAQARQRSEDVLPLVLGGLVGGVV 38 7 18%
4105 DAI-28-SVL DAIRPNLVQTIYGTPAFEHGGPFANIAHGCNSVL 34 9 26%
4106 AGI-26-LVL AGIRETDDLVEKIGVERSKKALLEADLVLLVL 59 16 27%
4107 SVL-27-GLL SVLVRFKGKMQPGITLRDLVNAIPLYAIKQGLL 58 21 36%
4108 LSG-25-VGI LSGGQFQRVLVARALAQEADLIFLDEPFVGI 41 22 54%
4109 SLA-24-GAG SLALASLLTGASRVLGFAADVIVARGTGAG 56 15 27%
4110 AGI-26-LTL AGIALFPFVMLSSTEDILSLTLWASLSSQLTL 48 9 19%
4111 VLE-28-LGL VLESALGIILDVFLAILAVDAEPKQAVLADSLGL 51 10 20%
4112 GIG-24-GGS GIGISPEDQERIFERFFQVDSSRSRKTGGS 45 21 47%
4113 GIA-26-FGL GIAGQIIAITLAAGLSEAAARLGIFGVDLFGL 45 8 18%
4114 EAI-25-FLG EAIEAVLDAVRRSRAGLHDPVRPIGSFGFLG 32 18 56%
4115 VIV-25-LGV VIVTTPGDVALLLALKSVEMFLKVNIPALGV 45 7 16%
4116 DIV-26-LTG DIVLLEAGDVVPADLRLIEAKDLKIEEAALTG 33 24 73%
4117 LLS-24-ELV LLSRQVGVPYIVVFLNKVDMVDDEELLELV 49 35 71%
4119 LLE-24-GLI LLEHENSDVRYRAASALGEIKSEQAIPGLI 46 20 43%
4120 ALG-26-LGI ALGGGCELALACDIRIASEDAKLGLPEVGLGI 68 30 44%
4121 LLK-27-VGL LLKKAEKAVEGNIKKPIKTWSRRSTILPQFVGL 43 11 26%
4122 IGL-28-TLA IGLIIAGKARNIGGVGGLLISSRTAILGDGLTLA 49 5 10%
4123 LEA-25-LIA LEALLAVADKTASLIITGNGDVVQPEDDLIA 48 19 40%
4124 GGG-25-GIV GGGFPLALQHLFIFAAHGEVRALILAGFGIV 42 15 36%
4125 IGG-25-GSI IGGNVATGAGARALAEAGADAVKVGIGPGSI 37 26 70%
4126 LGS-25-LGV LGSFSAAAEALGLSQPAVSKRVRALERELGV 49 26 53%
4127 GLL-29-AKL GLLSGAMEAGLALTTLELLLAAADAEGLAVLAAKL 48 6 13%
4128 LIG-27-VGK LIGREKELERTIQVLCRRRKNNPLLVGEAGVGK 33 26 79%
4129 LLT-28-LAT LLTPHPKAMTIDALKRLEAIASLEDLGAGFALAT 52 14 27%
4130 EVL-26-VDL EVLTPAREEGAADLPLAVYDDVGNLIARVVDL 38 10 26%
4131 SGG-26-AFL SGGTSFFSRAEIKDLLAYLRLLTNPDDDSAFL 36 17 47%
4132 SGV-24-SGL SGVTNSGLLLSGLGELSLVLTVDIAPRSGL 42 7 17%
4133 LVL-27-SLL LVLSLIGLLLSSVQALALVGLLGGALGLLASLL 71 13 18%
4134 SLG-28-VLA SLGELVKEEMGAVPGTIALFGCFLIMIIILAVLA 61 24 39%
4135 TLA-25-AAI TLAAIIANEMSANGLATSGPAAERAGDLAAI 64 13 20%
4136 LLG-28-GAG LLGCSVAGIGADRLAAAGALAGRLGAVVVLKGAG 78 16 21%
4137 LLD-26-DIL LLDRRDSFGTVTILFEDTISNDELLELDCDIL 41 11 27%
4138 LIG-28-NLA LIGEATAERIKHEIGSAYPGDEVREIEVRGRNLA 38 20 53%
4139 VLA-27-DIV VLATQTLKQGKAKTMKIEVEGKLAPGVTAKDIV 38 22 58%
4140 LEA-27-IVD LEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVD 36 23 64%
4141 GAL-28-LAE GALKNIIAVGAGALVGLGYGDNAKAALIARGLAE 70 22 31%
4142 SLV-25-ALA SLVGLGALLLVVPSGLAGGQEQRVALAAALA 69 15 22%
4143 FLL-29-DIV FLLDELQGAFYFMEMNLRVQVEHPVTEFVIGTDIV 29 9 31%
4144 TGL-27-AIA TGLLAFAAALNLLLLALFFAGSGLGGANPVAIA 52 9 17%
4145 LGF-25-AIS LGFFVFNHKPAKVFMGDVGSLALGGMLAAIS 33 13 39%
4146 VSV-27-IVD VSVGATITIMCAATLAEGTTRLENAAREPEIVD 31 15 48%
4147 GSI-25-IAG GSIGMLPSASLDANGKGLYEPCHGSAPDIAG 38 17 45%
4148 ELL-24-SIA ELLTRAGLEDRKDYEPGQLSGGQQQRVSIA 39 13 33%
4149 ALV-27-AIE ALVKQYQKLLELDDVELEFAEEALSAIAKKAIE 43 23 53%
4150 LAE-25-LIG LAELLFGDEDALIRIDMSEYMEKHSVSRLIG 49 25 51%
4151 LVS-24-SLL LVSVHAGASDVARGMFESADLLLVIGGSLL 53 10 19%
4152 LSV-25-ASL LSVGQAQRDALARALLLRLALLLLDEPAASL 50 12 24%
4153 AIG-28-AFL AIGTGLFLGIGPVIQAAGPSVLLGYAIAGFIAFL 44 18 41%
4154 IAV-26-VIL IAVIGDGQMSLGGAGEAGNGAGAVGGRGIVIL 39 19 49%
4155 LGS-26-GVL LGSLKSNIGHTQAAAGVGGVIKMVMALRHGVL 46 23 50%
4156 GEI-29-LLA GEIALRILRACKELGIKTVAVHSTADRDLKHVLLA 49 21 43%
4157 FLA-29-AGL FLAMVAAEIVVPLMLRAAGFPAAAVFAATALVAGL 52 7 13%
4158 FLG-25-ILG FLGPNGAGKSTTGKIGAGILKSAVGPASILG 40 12 30%
4159 DVI-28-ALA DVILAIDEIHEIVGAGAAEDGDEDLGNNLRPALA 51 15 29%
4160 LAL-25-AIL LALSSTALGLQALAEAGLILVPVGFLAFAIL 80 6 8%
4161 IAG-26-ALG IAGLLPKLLGLLRDADVRLAGLAASLVGLALG 64 6 9%
4162 KLA-28-EGL KLALIADSAKIIPTEAKFVDIAGLVSGASKGEGL 37 9 24%
4163 VSV-27-LLR VSVALGADPATILGAVTPVPDTLSEGAAAGLLR 41 9 22%
4164 TIA-27-LAT TIAVYDLGGGTFDISIIEIDEVDGEKTFEVLAT 37 12 32%
4165 NVL-29-LVD NVLQYFISTHGARKGLADTALKTANSGYLTRRLVD 32 21 66%
4166 LLG-27-ILD LLGEGFSPLVLGVAQAIASARLELENLYIAILD 44 6 14%
4167 LIE-27-SLA LIEKEIQEALKKNKAYVQTIMSMPGIGMITSLA 48 20 42%
4169 IAV-29-EVI IAVVHNGIIENYEELREELEAKGYKFKSETDTEVI 35 17 49%
4170 TGL-29-ALL TGLTAVGVAGLIALALAFEPLARGIGAVRGAEALL 69 8 12%
4171 EVI-24-GAS EVIFTVLHAGGKFGGGGYKTSGGLHGVGAS 31 22 71%
4172 LGT-27-EAI LGTRFLPATKAMPKEMLPIVDKPTIQYAVEEAI 33 15 45%
4173 SVV-26-IVA SVVAVDKNTGKVLAVGEEAKNMIGRTPGNIVA 35 21 60%
4174 ELA-25-ILA ELAIALMLGEETVLDGSDLGQVGFRVEGILA 48 8 17%
4175 AVL-28-IAA AVLIELLLVGGLPVRAASCLAVSTLDLAAAAIAA 77 17 22%
4176 VLG-24-IGL VLGIDNLVFGAILSDKLPPNQRDRARLIGL 60 15 25%
4177 EVL-26-VLL EVLPLMHFRIRGLHAAFVFVAEALGLELLVLL 47 6 13%
4178 SGG-28-AIT SGGMLQRVAIARALAIRPKVLIADEPFAALDAIT 36 16 44%
4179 VLD-26-VGK VLDTLTDREENVLRLRFGLDDGRTRTLEEVGK 32 21 66%
4180 AFL-27-ELA AFLSPKKENADDKVRLKTLSPGVTVLTKTRELA 42 7 17%
4181 LGL-27-LTG LGLCFLAEGAIPFAAADFRRVLPACVVGAALTG 68 12 18%
4182 LLS-24-LIG LLSRASGQLELGVGSPVAARLRVEGEGLIG 65 9 14%
4183 ALV-25-LLT ALVVAPAAVLADEPTGALDSKTGGAAAVLLT 69 9 13%
4184 LEV-26-EVI LEVDYDLSDVMFVATSNSMNIPAPLLDRMEVI 35 22 63%
4185 ALT-27-AIV ALTAEGDQEGALALALGLDGRLTGRLADARAIV 48 8 17%
4186 IVG-28-SLG IVGSFNAADALLALAAAAGAAGLFGGTTMAGSLG 42 12 29%
4187 IGV-28-AIG IGVPVKSKALSGLDSLLSIVQMPGGVPVATVAIG 43 31 72%
4188 LGL-28-IAG LGLAAVVALTGLTSSGAVLAAAALLLAILILIAG 64 2 3%
4189 DLL-24-VLV DLLLRTRTPFRSAVKAAGINRSEIDHPVLV 52 9 17%
4190 LEA-27-LVS LEAGLAAPAERYAAGQLGSERDSLVEALSKLVS 42 6 14%
4191 GVI-27-LVA GVIEGRRAFRNEAKYLELTASSNFGNVFSLLVA 47 18 38%
4192 FGL-29-AVL FGLIGAVPQGGIQVGPLGFARVRLSGLRLALFAVL 49 6 12%
4193 NLA-25-LLG NLALLYASQGKYSEAEPLYLQALALRAILLG 43 15 35%
4194 LLI-29-ILA LLIMAGAGSGKTRVLTHRIAYLIDEKGVNPLNILA 62 24 39%
4195 ALG-26-ELL ALGERTVEGAATIPLLSLRSAAANDAYRQELL 70 7 10%
4196 GLS-27-LLG GLSVLQGLLRAALGAALAPTVTVLGLLAGKLLG 68 4 6%
4197 AAI-28-SAL AAIKEFFGSSQLSQFMDQNNPLSELTHKRRLSAL 59 21 36%
4198 SLL-28-LGS SLLSALLDLGFARPLARLALALWPALTLGIVLGS 48 16 33%
4199 LIG-24-VVS LIGERGREVGIIIGILLEEEGGKASVSVVS 44 6 14%
4200 LLK-25-LPL LLKAIPDDLYEASAEDGALAAQNFFPIVLPL 44 7 16%
4201 AVL-24-GEL AVLDEGRPVLLAQALTEGWQRALAAPRGEL 50 5 10%
4202 IGA-25-GSL IGAGPGAPDLITVKGRRLIEACPVVIYAGSL 43 16 37%
4203 GVI-26-VLG GVILAGFSGGICTSDGSLVVLVTEALVGLVLG 51 6 12%
4204 ASG-28-GSL ASGKVLTGGVDANALHRPKRFFGAARNVEEGGSL 43 24 56%
4205 DAI-28-LLG DAILITIGAQLGLIADATESALGLLGDLRFELLG 44 12 27%
4206 LLG-28-VSG LLGARPGLLASIAAIGAASGLGALGVLAGLLVSG 52 4 8%
4207 AVL-28-EIA AVLLKKAAGIESGSGEPNKTKVATVTRAQVQEIA 49 29 59%
4208 LGG-29-LSL LGGIGPIGRLLCCSTFLGDFIPVSIKMAKDQNLSL 57 12 21%
4209 ILG-25-LDG ILGPSGCGKTTLLRILAGLLSPDEGRILLDG 34 20 59%
4210 LLR-28-GVG LLRMIAGLETITSGDLFIGELRMNDTPPAERGVG 41 11 27%
4211 GSG-28-SLG GSGADIAGLALGEGTLGTKNGGDGDVLEAGPSLG 40 6 15%
4212 ILD-26-LSG ILDEAQEAKNKAEKIALEFKAIDTWLAFALSG 39 16 41%
4213 LGF-29-ALV LGFLLFIAAGGAEAGPGFFSIFFRDALVGLMLALV 52 7 13%
4214 LDI-28-LVG LDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVG 35 17 49%
4215 LIA-26-IEL LIAPPFAIGIALFLTEAAPAWLKFPLGEAIEL 40 21 53%
4216 LSG-29-IEA LSGGLCVEMFAARDDIAVAEILLLDEPTGHYDIEA 41 16 39%
4217 IGG-26-LVE IGGTIVASDLLEILVTIEVDDTFLAKMIALVE 38 10 26%
4218 LVD-24-VVI LVDAQEGPMPQTKFVVKKALELGLKPIVVI 35 14 40%
4219 IEA-26-GFL IEARDLTKRFGDFVAVDHVSFRIPRGEIFGFL 33 20 61%
4220 GEI-28-VLL GEIALRILRACKELGIKTVAVHSLADRDLKHVLL 38 18 47%
4221 RLI-27-LGL RLILYIPVSVTLGFTSGIGILIGSLLIKDFLGL 44 7 16%
4222 IAD-28-EIL IADMLTRIRNANMVRHEKLEVPASKIKKGIAEIL 34 23 68%
4223 AVL-29-LVG AVLNTLVPLLLALAVLARLQRGLVASSTFAGALVG 67 7 10%
4224 SAL-28-VLN SALAFKIATDPFVGNLTFFRVYSGVVESGDTVLN 38 19 50%
4226 VLG-29-LID VLGGRAMEIVYDEEELERYMTEAVKVSPEHPVLID 39 22 56%
4227 LAA-29-LEV LAACEGALLVVDAGQGVEAQTLANCYTAIEMDLEV 55 19 35%
4228 LGG-27-VLV LGGRGMEIVYNEEALEDYMTRAVKVSPEHPVLV 63 20 32%
4229 VVL-25-LGA VVLRLLAALGIPLDKVNVNGGAIALGHPLGA 67 19 28%
4231 VGL-24-LVS VGLLHGKLSAAEKLEVGQKFRVNEIRALVS 48 7 15%
4232 LSV-27-GVG LSVGEPKAVMNRVLEFTTPLLPADKPRYLMGVG 39 22 56%
4233 EAI-27-LAL EAIARNLAEMADLKVPIIAIIIGEGGSGGALAL 53 14 26%
4234 NLL-26-AGL NLLLGSLGLDAVALAAIARLALDLKDLEDAGL 45 7 16%
4235 GEL-27-VLV GELHCVGATTLDEYRQYIEKDAALERRFQKVLV 42 20 48%
4236 IAT-26-ELL IATPSATVAAVTAAGIVPPVGAKLLGVNVELL 38 14 37%
4237 GLF-27-LEL GLFDYPVLMAADILLYQANLVPVGEDQKQHLEL 32 27 84%
4238 ALI-27-LIV ALIVAPPIGGKVLALQAIAAAITKGRGELGLIV 50 14 28%
4240 RLL-25-VVL RLLGCSVAEVQADRLAAARALALRFGAVVVL 51 14 27%
4241 GIL-26-VLA GILPDLFREGQGVVAQGVLTLAGFGFALEVLA 59 18 31%
4242 LLG-24-LAS LLGIGLLGLLAPLAPLGLLFMPGAGLGLAS 79 6 8%
4243 ALV-25-LLI ALVIVLGAAVLTALKARILTLILSILSPLLI 65 7 11%
4244 ITA-29-AIV ITAAGKVPPAKVLVIGAGVAGLAAIGAANSLGAIV 35 14 40%
4245 SVV-29-ILG SVVDLTVIAKKATTYEEICAAMKAASEGELKGILG 33 19 58%
4247 AIL-29-YGL AILGDHITLDAGTGAVGEAPGVGPVDAVIGQKYGL 33 9 27%
4248 AVL-24-AAI AVLELTASELGVEKAREMAEALLTGLLAAI 71 7 10%
4249 GIV-24-VGI GIVSRSGTLTYEAVKQTTDEGFGQSTCVGI 40 25 63%
4250 VVS-28-VIG VVSKWTGIPVSKLTEGESEKLLNLEEILHSRVIG 39 19 49%
4252 IVL-26-VIL IVLGTIGMGFAWIYASQAWFTSSGLGDAGVIL 42 6 14%
4253 VEL-26-LVG VELPNAFEALMRGLTLEIDLSLSMEVIAALVG 41 7 17%
4254 ALG-25-TLG ALGGGLELAMGCDALIAADAAKVGVPEITLG 54 12 22%
4255 AIL-26-GLD AILINTARGAVVDENALIKALKEGAIAGAGLD 40 15 38%
4256 LAA-27-SGV LAAVHTLGIAVDLPTALLLSVVAALSACGASGV 62 20 32%
4257 LVG-28-GIT LVGVGYRAAVKGNVLNLSLGFSHPVDHQLPAGIT 39 16 41%
4259 VIG-26-LIA VIGQSINLSPADKKIYLLRDVTGTVNSIPLIA 55 12 22%
4260 LTG-28-LGV LTGVVLTKVDGDARGGAALSIRVITGKPIKFLGV 52 11 21%
4261 GAG-28-GIG GAGGAGGLGGAGGLGGGLGGVGAAAGLGGAGGIG 71 13 18%
4262 IAS-24-GIA IASIFGVGSASHLLASDPGLEMILTLFGIA 40 5 13%
4263 VAI-24-AIE VAILDAALTEGVPPHVTADTGIDALTHAIE 33 14 42%
4264 GLL-24-IAL GLLAAIESALSITRLTLIVLASLILIGIAL 72 6 8%
4265 AIG-27-VLL AIGAAGLSRLLSANVFAKSGLAVELAGDPDVLL 61 11 18%
4266 GAI-24-LAL GAISVLSGMAELADVGLLGLALGASLALAL 59 11 19%
4267 VSL-29-VAL VSLDKARRLLWPIKQKYGLKISWADLFIGRGNVAL 49 13 27%
4268 VLI-25-AGI VLIIEALAQNGAAALLNSEENKGKGALFAGI 48 14 29%
4269 TLA-27-DLA TLAAIKMAKDAGYTAVISHRSGETEDATIADLA 60 15 25%
4270 LLR-24-DLV LLRPVDDLELTVRSANCLKAEAIHYIGDLV 47 18 38%
4271 EAI-26-VLD EAIQWVNIAFMAVCRVINGAATSLGVLLIVLD 38 9 24%
4272 FLA-25-GIG FLASKITFINEGADLCEKVGADVQSVANGIG 40 11 28%
4273 GLG-25-IAL GLGLILIAPLGGILDALGFGLVTLALTLIAL 66 8 12%
4274 LAK-27-EVL LAKTLLYAINGGVDEKPGNQVGPKTAPITDEVL 48 13 27%
4275 LGA-24-LLV LGALDLLTRLGMGLLIAQLLGLHLVAVLLV 74 9 12%
4276 VSL-29-FGL VSLGGVVTRLFGFQAQLPLMLIAIGALLALPTFGL 38 8 21%
4277 LPL-28-LGV LPLLTTFVLLQVAEAADFGYLTSILGLLLIALGV 54 10 19%
4278 PLL-26-GVL PLLAPMSEVAGRLARQFGAQALARALGGAGVL 57 14 25%
4279 GAI-29-AGL GAIGALYKMNASISGAEVGCQGEVGVACSMAAAGL 63 22 35%
4280 GVG-24-GIV GVGALLALMLAGAELSVIAIIGIILLIGIV 41 26 63%
4281 LDA-25-LVA LDAATRSLRTGLQDLLANLIDFLKRGTSLVA 64 6 9%
4282 GAS-24-LLA GASGGLLASATALGRLGAVLVVAAGEALLA 76 7 9%
4283 DAI-29-VLA DAIRENLVLTLYGTPALEHGGEFLNIAHGDNSVLA 44 16 36%
4284 EAL-28-RLI EALLQALMPYRIYGGMRFFERQEIKDALAYLRLI 42 14 33%
4285 ELA-28-EGL ELAQIVIALIAANTVLEFVDIAGLVAGASILEGL 48 6 13%
4286 GLA-28-DVL GLAAAGDAALTILPLGGAGRVLGIRALAALEDVL 52 12 23%
4287 EVL-24-LIA EVLEGVSAIAPTGEWVLIEGLRGTGKYLIA 42 9 21%
4288 EIA-29-LVE EIASASDEQSRGIEQVGQAVSEMDEVTQQNASLVE 42 21 50%
4289 ILD-27-ALV ILDLPLLDLRAARAAAENERPTTTRVAKATALV 41 7 17%
4290 DIL-27-LLT DILMLLGQELLILGITLLELEDAKPAGEIGLLT 40 14 35%
4291 GGS-27-LLT GGSDQWGNILSGIDLIRRKGTAQAYALTFPLLT 38 17 45%
4292 AAL-28-ILL AALAALAAAAALGVGAAGLLPALLAIGAGATILL 69 7 10%
4293 LSL-26-TLL LSLAPYLAMGFLSLILDYLALVALAAGGFTLL 71 8 11%
4294 ALS-28-LDI ALSGGEKQRLLLALILAQEANLLILDEPTNDLDI 37 17 46%
4295 AGL-27-ALN AGLSSAAALEVAVGTGLEQLYHLPLDGAEIALN 49 10 20%
4296 LAK-26-GEL LAKIVTVVVADLALALAIVSEAGTHLRQRGEL 43 12 28%
4297 VSL-27-EAL VSLENLFDLLKAGEPKSVNVIIKADVQGSVEAL 54 19 35%
4298 EIL-29-VLG EILRAERFVSAADLQETLTRYLWAYNHRIPQRVLG 39 12 31%
4299 ALT-26-GVG ALTIALKLIGAGLGLESKPRGSFLKAGPTGVG 47 8 17%
4300 GIV-28-VAL GIVLSLLAKGGGKSLLLILALLLRLLEDGAGVAL 49 1 2%
4301 GEL-28-VSG GELSRLMLAIKSAFSRKEGKTSIVFDEVDTGVSG 38 20 53%
4302 LAT-26-LNA LATIIAARLSTLIMAEYANHPYALAPGMGLNA 39 11 28%
4303 TGL-27-VLG TGLVGPSGAGKTTLLRVIVGLSGALGGALAVLG 50 11 22%
4304 AFL-24-LLG AFLAGVLLASSEYRHALEADIEPFKGLLLG 57 18 32%
4305 ELA-28-GVV ELATRFLTGGIGIAEPGVALLIAGTLIRLDGGVV 51 5 10%
4306 LAI-25-IAS LAIKDTGNFIKIDVQTILMGMAASMGTVIAS 45 9 20%
4307 VVL-25-LVV VVLSRQIASLGIYPAVDPLDSTSRQLDPLVV 54 14 26%
4308 AAI-24-TGL AAIGAARATGKVGVCIATSGPGATNLITGL 47 11 23%
4310 VAI-25-LLP VAIAGLIGEEGDAQPHKARIEEGGRKAVLLP 42 13 31%
4311 LGL-28-LLK LGLSPGATFFRLILPQAWRHALPGLGNEWLVLLK 61 21 34%
4312 TLG-26-GSG TLGMEGAQALDDLQATVIPGGLVLVVGPTGSG 37 7 19%
4313 LGY-27-GVL LGYREIKQTMQLSRLTLRSKKPELVEQELWGVL 34 20 59%
4315 ALL-25-VLD ALLAALVQAPSTLAPLLAPEAALARRGRVLD 69 11 16%
4316 LAL-25-IAT LALAAAFILIEAAIPPKPLIGAEVPAGMIAT 58 7 12%
4317 LLD-29-LNA LLDDIATLLDDGELLTKQAAKKTAGVLGDLLELNA 42 12 29%
4318 LTL-29-LGG LTLGQEFSGYVAMLDHLLRSIEAALPHLAELALGG 51 17 33%
4319 AGL-26-LVF AGLPVARAINIPTAGALAYGLLVLLRVAVLVF 50 18 36%
4320 LGA-27-ALI LGALLVLLIGLLAKLLNYVIAGLAPLFPTFALI 70 9 13%
4321 IGL-24-VLI IGLAATQVDIHQRIIVIDVSENRDEALVLI 53 16 30%
4322 IAG-27-VGI IAGFKEIEYEVMRDSADNAAVVCNMENFDPVGI 41 20 49%
4323 GIG-28-VAI GIGVSRVVAAAIEQNDDERGIEWPDAIAPFQVAI 40 12 30%
4324 LIV-28-TLL LIVEDIIDSGLTLSKLREILKLREPKSLAICTLL 46 23 50%
4325 LLF-26-SAL LLFTGAMGKSAQFLLHVWLPDAMEGPTPVSAL 49 16 33%
4326 ATL-27-VLV ATLLHDDVVDESDLRRGKATANALWGNAASVLV 54 25 46%
4327 DLI-26-SLL DLIVTAAFGQILPEDLLGAPKTGDINVHASLL 40 16 40%
4328 GGI-28-VLV GGIFVDAAICDAFGAADLLIAEASSVAALAAVLV 41 10 24%
4329 VDL-27-SIA VDLDSDPTKLIEVVEIGKQLLMTRGALTTFSIA 33 24 73%
4330 VLS-24-VSG VLSVKMQDPQFAGQTKERLSSRQAAAFVSG 41 14 34%
4331 LPL-27-VIA LPLVISLLVVHGGLSLAASLLLSGLAVVGRVIA 45 5 11%
4333 TLG-24-LGT TLGGQTGLNMAMELSKAGILDELNVELLGT 37 27 73%
4334 GDL-29-AEI GDLSENSEYEAAKDEQAFVEGRISTLETKIRYAEI 34 17 50%
4335 SLA-24-LLG SLAGGLGLIVGILLGALILLALNLGALLLG 86 9 10%
4336 TLL-27-VLV TLLNELKAEFNTAIDRLTADLLVVVGVCDGVLV 59 9 15%
4337 VVL-24-LIG VVLAAALAARVLHLTEELGTLALAKPRLIG 55 6 11%
4338 GVL-26-AAI GVLVGYLLGLAMRRIADSHAGEAATDARDAAI 54 12 22%
4339 ILG-24-LLR ILGDVLGADDLFEIAIENRGLKAILDRLLR 49 1 2%
4340 IAA-24-IGV IAAVVLGGTSLSGGLGLIAGTLIGALIIGV 48 17 35%
4341 AIS-29-AVL AISAALLLALAAKKGLGALAVGAVAILAITKKAVL 48 6 13%
4342 AIS-24-LTG AISTSGNSLDIIKAIEAAVTRDMTIVALTG 41 17 41%
4343 LAL-28-LSV LALGGALGTIAVLLRQELLLVIMGGVFVVETLSV 68 36 53%
4344 LLT-26-LLV LLTIAAGLLGLLGLALLAAILLLLVLAVALLV 66 2 3%
4345 LVE-25-GGI LVEAGYAPEMAYFECLHELKLIVDLIYEGGI 35 16 46%
4346 RLL-27-LLP RLLGKKTMENELLKEAVEYLRAKKLIAHAPLLP 69 14 20%
4347 LVV-27-LVV LVVALGKVLNRLLEGLIAPEFLAAALLAVGLVV 55 4 7%
4348 GIV-29-ALL GIVSAVMVALEQCPPELASDISERGMVLTGGGALL 70 18 26%
4349 ATL-28-GAG ATLDAVRMRLRPILMTSLAFILGVLPLAISTGAG 55 21 38%
4350 IAV-26-GVG IAVSAEGSLVSYAELNARINRLAHALSGLGVG 38 11 29%
4351 GAI-25-LLP GAILGLTTVMLVMLYGQTRVIFAMSRDGLLP 40 15 38%
4352 ADL-27-LDV ADLNWENPAVRAELKKVLEFWADKGVDGFRLDV 40 19 48%
4353 AFL-25-ALA AFLQQILLRPAEYAVIACMNLNGDLISDALA 68 13 19%
4354 LEV-25-VEL LEVCPKCDHGARGRARVPLGASLGEGEAVEL 39 20 51%
4355 IVV-24-GEI IVVEHDEDTMRAADYLIDIGPGAGVHGGEI 33 22 67%
4356 ALS-27-LLR ALSISVLLVVVFTLLTLDFAAFPTILLFSTLLR 60 13 22%
4357 ILG-27-LLG ILGFLHLLAYKVLEAIILKLLNNILEIISSLLG 63 6 10%
4358 ALE-24-IAD ALEHKPKDIVAGASAYSRRIDFAKFREIAD 41 18 44%
4359 SLG-24-GAG SLGVVRMDVEVSFVVADIPGLIEGAAAGAG 46 12 26%
4360 VIL-24-VLI VILDLGLPGMDGLDVLREWRAKGKSDPVLI 43 12 28%
4361 VIL-28-AIG VILCLSFLVAIGFSLVAEGFGFLIPLGGLYAAIG 40 12 30%
4362 SGG-29-GVG SGGEGGRGGLAGEVGLAGSGSGGTGVFDEGDGGVG 45 20 44%
4363 IVA-27-VLV IVAGLAPAGAMTIEQTRQGLLAALALLLVAVLV 48 7 15%
4364 IAS-27-ALV IASASAEQSLGIDLVGLAKAEMDLATQQNAALV 46 8 17%
4365 DLA-24-LVS DLARICSPASRKLADLGKVDRYSYVMHLVS 42 13 31%
4366 AKL-28-LLE AKLLFLGQEDKLLVLDLMRRWSSCMRAAYKRLLE 44 12 27%
4367 LGS-29-AIA LGSSCIYPKLALQPLAESELLTGTLEPTNEPYAIA 49 14 29%
4368 EGL-24-AIV EGLSTAIIGRPNVGKSSLLNNLLREEKAIV 35 24 69%
4369 ILD-27-LIV ILDEPSIGLHQRDNDRLIEALKKMRDLGNTLIV 33 19 58%
4370 VIV-29-TLL VIVAAARSGGVLELRVLRRYTVSAGLIAGVGLTLL 40 6 15%
4371 IAT-26-RLL IATITGGVAYMNHAEVFSENQDIVVATTGRLL 35 9 26%
4372 IGL-28-SGV IGLNDSGGARIQEGVASLAGYGVIFKRNVLASGV 38 15 39%
4374 VLE-29-SVL VLEEGVVGGRTTFGNILKYLNMTASSNFGNVFSVL 40 15 38%
4375 LSV-24-GLL LSVLIGAVVGLIGANGAGKTTLGFIVIGLL 58 8 14%
4376 GVI-27-VVI GVIVAMTLAEAEAAIRDMLAGNAFGDAGARVVI 36 15 42%
4377 GAI-28-LDV GAILINACRGAVVDGTALLTALAVGQPLSVVLDV 32 10 31%
4378 GVG-28-VLG GVGAAGLGLLLLANFLTLLGAAAAVFGLFATVLG 50 6 12%
4379 TLI-29-GIV TLIEQAEQGVDYFTIHAGVLLRYVPLTAKRVTGIV 39 26 67%
4380 GEI-29-SLV GEIASASDEQSRGIDQVALAVSEMDLVTQQNASLV 33 13 39%
4381 IAT-25-ALT IATGFGRTGKLFACEHAGITPDILCLGKALT 37 21 57%
4382 VFL-29-GIG VFLMGVLFTVISATGIRSWILRNLPMGVAHGTGIG 34 13 38%
4383 LGL-28-GLD LGLTGAEYAALALLPLGVMGLLFPILVGLAAGLD 54 7 13%
4384 LLI-27-AIV LLIALPLNVFNEYEDGAVGLLALLAVGIGGAIV 48 6 13%
4385 VSL-27-GAG VSLRFGDRKLFDDVNIKFTEGNCYGLIGANGAG 48 19 40%
4386 ELG-24-LGG ELGAVVGAAPAETVPEEKGEALDVCILLGG 43 15 35%
4387 AIS-25-FLL AISAYLLLDLLRTAEVQAKPATVILALDFLL 38 7 18%
4388 ALI-28-LVL ALILDPILATAGSLLATIILLKAAGALLIKVLVL 69 9 13%
4389 GLA-26-GLV GLAGTAVLGLAAAAAGAAALAILDGGRLVGLV 69 7 10%
4390 GIG-29-AAL GIGSAGLAANAAAAAPTGGLLAAAADEVSAAAAAL 74 11 15%
4392 IAL-28-LLK IALAALLGDILIIADEDTLATDIVAQLVVLELLK 50 6 12%
4393 ALG-26-LVG ALGFGLSALSLLALLAALGLTLLLDLLAALVG 76 4 5%
4395 VAL-27-GLG VALRCINPLCPAQILEGLIHFVSRAAMNIDGLG 66 20 30%
4396 LDL-25-GIL LDLSLVDKVEGVTSEEAISTARRLMEEEGIL 36 17 47%
4397 RLL-28-DVL RLLVDMGLNWLERLPLIVGGRLPLTFSQRLYDVL 47 11 23%
4398 GIG-29-GLF GIGLSGSGQGNIGLFNSGAGNIGLFNSGTGNLGLF 40 13 33%
4399 LVI-27-LIG LVIAPDICLAAFSEIIRGIIAGAALLLYLALIG 49 7 14%
4400 GAS-25-IAA GASRAATLATVILAAGAPGLILAGAAAFIAA 52 6 12%
4401 LDI-27-GFL LDIDASEKAARFVRFCDAFNIPIVTLVDVPGFL 30 23 77%
4402 IVD-27-VLE IVDRKKDMILVSGFNVYPNEIEEVVATHPKVLE 33 15 45%
4403 GLL-25-LGF GLLVTMGIGSSFLTLPIAAAIFVGLLVGLGF 53 10 19%
4404 VIA-24-LLV VIAVLGAAGLAVGLALQGSLSNLAAGVLLV 53 10 19%
4405 ALN-27-DAL ALNGAQNLAQAKTAAGNTINNARDLNQKQKDAL 39 17 44%
4406 ITA-28-LGV ITARLSMSLNNTPLQGAHINVVSGNFTIAQPLGV 41 11 27%
4407 ALL-25-VEL ALLPTLGGQTALNMALELAENGVLEKYGVEL 60 21 35%
4408 VIA-24-ITA VIAEVLKEQGVKPCRPLSTAVVSAQIAITA 37 13 35%
4409 IVL-24-RLI IVLNPGNLATIYQSLKKTDKEDSLKIARLI 35 20 57%
4411 IGA-29-AIA IGAIVAGLAVLASAAAFIIALISIKMPAQVPLAIA 59 13 22%
4412 GGI-25-AAL GGIVDLLLAAPALARAAFALLIGAGVATAAL 63 1 2%
4413 RIL-24-GIS RILGLGDQGIGGMGIPIGKLSLYTACGGIS 33 13 39%
4414 DAI-29-LEL DAICHVVRCFEDENITHVSGKVDPIRDIEIINLEL 35 19 54%
4415 VFL-24-IPL VFLDITATAEGRDTMIDVVERTAEQVFIPL 33 20 61%
4416 EAL-28-ELA EALALLIDGAVAAILLAFAAIAEVDEGKAGVELA 70 4 6%
4417 LLI-29-ILG LLILYLTSQLGFVDGHAILLFSAGKLLVYVTPILG 60 11 18%
4418 ILL-26-LVS ILLILSAAAVFSGLIGNAISLFGMLLIALLVS 47 6 13%
4419 ALV-24-GEI ALVHSRFSTNTFPSWELAHPYRLVAHNGEI 46 19 41%
4420 LDL-28-SGG LDLKFHDIPNTVAKAVAAAADLGVWMVNVHASGG 44 24 55%
4421 GVL-29-VID GVLPGPLNVPRRASALRRLLVSSDLLSADPMNVID 35 13 37%
4422 VIA-26-IAD VIAQHTGADSASVIFDAIQAAKARGIDVLIAD 39 15 38%
4423 GIG-24-GDL GIGLFIALIGLKNAGIIVSNDATLVGLGDL 46 21 46%
4424 TLI-25-LGL TLITLSDELMKQGILAAGEALLKFVAQALGL 49 10 20%
4425 LSL-29-LLI LSLFTLAMLILVTADNLLQVFFGWEGVGLASYLLI 69 14 20%
4426 IAL-27-LPL IALALRDEVLDLEAAGIKIIQIDEPALREGLPL 56 28 50%
4427 TLL-27-ELA TLLKALSGLLKPSSGEILIDGKEIAELDEKELA 56 23 41%
4428 ILL-25-AIA ILLLGMLQLPVINPIKVAPDIGGAVRAAAIA 61 9 15%
4429 LAI-27-LDG LAICGGLGRGALIADDLAELAQILTLGRIPLDG 39 2 5%
4430 VLV-25-VSV VLVRLPAGELLIVVDVAKDYGLASELGAVSV 42 6 14%
4431 GIG-28-ELG GIGRPSTYAPILSTIQSRGYVILENKRFIPTELG 43 18 42%
4432 LPL-24-LDI LPLEMMVWCIVGMALERKEPLHQIVNRLDI 34 19 56%
4433 EIL-24-TLA EILKGVNLTIEAGEIHAIMGPNGSGKSTLA 38 14 37%
4434 IGG-27-LDL IGGSEREDDYDALVARMKELGLDEEDYEWYLDL 37 27 73%
4435 DLA-27-LAE DLAQAARARYPPGSALLLWALAELAIIACDLAE 62 16 26%
4436 LAT-25-DLL LATAVAVLSGARAALAADVLSAAGLGAIDLL 46 4 9%
4437 LIE-28-VIE LIEKIAELVKDKKIEGISALRDESDKDGMRIVIE 36 28 78%
4438 LLG-27-IGV LLGYTGAALAALGLLLADSLALAIDPIGAGIGV 55 4 7%
4439 GLI-29-LAK GLIVIDYLQLILGTSPENRQQEVSEISRQLKILAK 44 13 30%
4440 VIG-29-LSL VIGTERHESRRIDNQLRGRSGRQGDPGESQFYLSL 52 24 46%
4441 GVI-25-LPL GVIAALVQILEMFLDKFVPLLYNALGIFLPL 40 12 30%
4442 GAI-29-GVG GAIGSPQLLQRSGVGPADLLRALGIPVVHDLPGVG 43 26 60%
4443 LAT-27-IVL LATQTLKQGKAKTMKIEVEGKLPAGITAKDIVL 44 23 52%
4444 ISA-29-ALE ISAGLDYPGVGPEHAYLNDIGRADYVSITDDEALE 40 26 65%
4445 LLL-25-SVV LLLVLGFSSSEAALGLLMAGMEKAGLIISVV 53 8 15%
4446 LLS-25-LGG LLSAQLTGILSSLVASVPLGLLLLLGAGLGG 59 6 10%
4447 EAL-28-AIV EALALVGLQGYEKREINEMSGGQKQRVAIARAIV 46 13 28%
4448 DLL-24-LAE DLLVVDEAHHLVWSEDAPSREYQAIEALAE 64 11 17%
4449 ILL-29-DLL ILLLPKDPNDDLNIILEIRGAAGATEAALFAGDLL 49 8 16%
4450 GLG-25-GLS GLGVLPPHLALPAAFAIAAQAAGDLVLLGLS 58 7 12%
4451 AVL-24-VEL AVLGHSGAAAVDPDRAFRDLGFDSLTAVEL 48 22 46%
4452 LVS-24-LAE LVSRYDSLRNPLTSLGDYLDPELISRCLAE 50 18 36%
4453 AIV-29-ALV AIVVVENVERVMAEEGLPPKEATRKSMGQIQGALV 52 29 56%
4454 GGS-26-LGT GGSTNDATPTLTGTAEANSTISIFDGTTLLGT 36 22 61%
4455 GDL-26-VIV GDLGVEVPLEEVPLVQKRIIKLARRNAKPVIV 31 17 55%
4456 GFL-26-AVL GFLWFNTYPAQVFMGDVGSLALGGALGIIAVL 47 14 30%
4457 DVI-28-GLA DVIEAGFPLSSLGAFVGVEPIASERLLGTGCGLA 38 12 32%
4458 IVD-26-ALN IVDPVVVDEKMYVARISGFIQLIRKSRFHALN 31 21 68%
4459 IAG-25-LLL IAGMDRLALANVLAASGRAVEAAGDVDVLLL 73 17 23%
4460 ILL-28-FLL ILLAEIQADRLLMAYDTIIIDEAHERSLNIDFLL 60 20 33%
4461 LAK-27-NAL LAKLLMEGGNFLILDEPTNHLDIDSKEVLENAL 38 20 53%
4462 IGL-26-VIL IGLAAALLILAILFISTALAAFVLALLLAVIL 47 6 13%
4463 LDL-24-EVL LDLGHYERFIDINLNKYRNVTTGKIYSEVL 45 17 38%
4464 GAS-27-SLV GASDDLAGGRSTFMVEMRETANILHLATIISLV 38 15 39%
4465 AIT-24-SVV AITITVLTLAAVHTLGIPVDLPTALLLSVV 29 20 69%
4466 LIA-26-GAS LIAAAAAGEATVPAFSATIGDVVEIFAGVGAS 46 15 33%
4467 VLA-28-GFL VLAGFIAFSIADRPGLAPGLVGGLLALLTGAGFL 46 18 39%
4468 ALV-26-ILG ALVANGLRGKIRLLVDGGLKTGVDIIKAAILG 54 10 19%
4469 AVL-26-VAI AVLIPGAAAPKLVTREMLEGMAPGAVIVDVAI 52 15 29%
4470 GLI-28-ILA GLIVIDYLGLILGTVSENRQQEVSDISAQLKILA 50 11 22%
4471 ASL-28-ALG ASLVGGARQVAAAARLAALDRAALILLELLAALG 70 6 9%
4472 VVL-26-IVA VVLVVAADDGVMPQTAEAIQHAKAAGVPLIVA 47 15 32%
4473 IAA-27-VAL IAAVVGQVAAAVTLIALAVALLALDLAAAAVAL 70 6 9%
4474 VIA-25-EAL VIAQANDTEFGLAAYFYAVDLSRVARVAEAL 54 9 17%
4475 GIG-27-VFL GIGYDWTGLSYQEKLSGNQAPALYALSLLVVFL 34 17 50%
4476 LID-24-LVE LIDASSEQAARSALNSLQGAFSARVLDLVE 39 12 31%
4477 GAG-25-LVS GAGPGDPGLLTLKGLQALQQADVVLYDRLVS 44 35 80%
4478 LDV-29-VVS LDVTDQAQILRLMKELALKGGTRVLLITHDIGVVS 32 17 53%
4479 ALE-24-LLS ALEGLLAADLELILREPDNALVADYQTLLS 53 14 26%
4480 AIL-25-LTG AILRQDPDVVMVGEIRDLETAQIAVQASLTG 48 19 40%
4481 EVL-27-ILG EVLVEIKATGVCHTDAFTLSGADPEGLFPAILG 37 18 49%
4482 AAI-25-IGL AAIIWNLGTWFFGLPASSSHTLIGAIIGIGL 61 13 21%
4483 LVV-25-LSL LVVGSSVGGASRWIMLGLVLGQPALVTKLSL 55 8 15%
4484 VIL-29-LVA VILTDGEQLKSLSVLALVFAALLKIVHGRVNLLVA 47 15 32%
4485 TLG-28-VLI TLGGTLGGIAGNLEEGIEIVEAGLDASRINQVLI 36 10 28%
4486 EIV-29-LDG EIVGLFGDGGAGKSELLRLRFGLVAADSGEVLLDG 34 13 38%
4487 LGV-27-LAI LGVPVQSAALSGVDSLYSIVQMPAGIPVGTLAI 64 20 31%
4488 GAL-25-ALI GALILTLGDGGALLLARLGRELSAGVVTALI 65 6 9%
4490 SLL-25-AIL SLLAGTIFDGDFEARQKLTIKQLELIALAIL 60 7 12%
4491 LIA-28-LGA LIARLLAGLARVNTVLLSGAGFLAIVAAAASLGA 69 2 3%
4492 LIV-26-ALI LIVWAVLLLALAAGPFLILLSLTGDALLDALI 49 6 12%
4493 EIA-27-LTG EIATGFGRTGKLFACEHAGIAPDILCLGKALTG 38 26 68%
4494 IGA-24-IGV IGADVSHLNLHKTFCIPHGGGGPGMGPIGV 42 14 33%
4495 ALT-25-IGL ALTGTALGLLVAAAALQFQALLLHPAVLIGL 46 10 22%
4496 IEA-25-AEI IEAANFPFATIEPNTGVVPMPDPRDDQLAEI 37 9 24%
4497 AIE-28-LSG AIEAKEGVEIQDENQTLASITFQNYFRMYKKLSG 39 23 59%
4498 ILD-27-VVL ILDEPKAALDEVERSKLQQILRALINKGGTVVL 36 6 17%
4499 GVS-25-LPL GVSFALGAFFAGMVLAESELSHAAAEDSLPL 41 11 27%
4500 LLV-27-RLI LLVLLKNRAGESNLVRLSVLFVGGLSGLYWRLI 48 9 19%
4501 LLK-27-ALS LLKKAGLDGSLDTIIAELGIGYKQRVEIAKALS 53 12 23%
4502 ALK-27-LLG ALKHGDIAIVEEEILLGINASRVGFATLINLLG 55 4 7%
4503 GVL-24-GLD GVLLYLRQEGRGIGLANKVYAYAGQDLGLD 50 12 24%
4504 TLA-28-ISG TLAEGGTVSENAAREPEIVDLAAFLATLGAKISG 41 13 32%
4505 SGG-29-GVS SGGELSRLMLAIKSIFSRHEGKTSIVFDEVDTGVS 39 23 59%
4506 SGI-28-GLG SGIGIAEEKLKRIFERFYQADSSTSRRYGGTGLG 43 24 56%
4507 IPL-24-VLA IPLSLIGVAMLMLAFGFSLLLLTLLAMVLA 43 12 28%
4508 LGL-26-GVG LGLGGLGVGLLGGALALSLLLLGVALVVLGVG 59 2 3%
4509 SLL-29-VID SLLDPLSKVAGRNNQGKLTVRHHGGGHKRLYRVID 39 11 28%
4510 VLL-27-AAI VLLGITKASLETDSFLSAASFQETTRVLTDAAI 63 19 30%
4511 AIA-26-VIE AIARALAEEPEVLVCDEPTSALDDEGLKQVIE 38 10 26%
4512 LTG-29-SGI LTGKEAEAALGRAGITVNKNAIPFDPESPFVTSGI 36 25 69%
4513 VLT-24-LLL VLTGIAAFLGLALQLAGQLPLEGLIGGLLL 65 7 11%
4514 SLL-25-VLG SLLLGLWALLALAIATAILLAAFVAVGLVLG 64 7 11%
4515 SGG-29-GSI SGGLGTMGFGLPAALGVKLALPDETVVCVTGDGSI 39 24 62%
4516 VEL-24-DLI VELRSHIQFYDGIKTSDIHETIIKAAADLI 34 17 50%
4517 ALS-28-IAD ALSAALTGGKGGKVVGTVVASLALESFSSQKIAD 41 11 27%
4518 IGL-25-GVV IGLINSLSVYARTNEYGFLETPYRRVVDGVV 44 18 41%
4519 VVL-28-LGG VVLGAGPAGYSAAFRAADLGLETVIVERYNTLGG 63 21 33%
4520 VLI-27-IAA VLIETLLAGGAEVRWASCNIFSTQDHALAAIAA 48 13 27%
4521 ELI-24-LLV ELIPWSTLSGLVKHYARHGWSRDFGEALLV 42 10 24%
4522 GLF-28-LTL GLFIAARAAEFVRAALQSIPRGQGNAALAMGLTL 43 7 16%
4523 LGL-26-GVI LGLQTYFTAGVKEVRAWTIKKGATAPQAAGVI 54 17 31%
4524 LLE-28-DLA LLEENGKDAVKVRSVVSCDTDFGVCAHCYGLDLA 58 9 16%
4527 VSL-26-LSA VSLSGGQKQRIAIARALILNPELLILDDSLSA 52 13 25%
4528 GIA-28-GLI GIARGVFSNESGLGSAPEAAAAAKTTEPVIAGLI 58 11 19%
4529 GAI-26-LLI GAIFAGLICLLPERLISLTGILLYLGGTSLLI 49 8 16%
4530 ALN-27-RIL ALNLERDSVGAVVMGPYADLAEGMKVKCTGRIL 30 23 77%
4531 GLA-27-ILL GLALSSTALALQSLAERLELNADIGRLAFAILL 59 11 19%
4532 VLE-26-ALA VLEKAAGAEALAAALRALAGVTHRVETAVALA 81 7 9%
4533 ELA-25-GLI ELAGISNPLMAILGLVMAGPWGSIIIAAGLI 45 7 16%
4534 LVA-26-GVG LVAAGALSLADAAALVRELGALMAAAAPVGVG 53 12 23%
4535 LEL-26-LLR LELTKPVRNGGLEAELVGTDSTLAEVLELLLR 62 9 15%
4536 IAG-24-ALS IAGVRVTGIADEPEVRIFSDPAMSQANALS 54 11 20%
4537 IGA-26-GIA IGAAMAWDAEKAGVLSPGVELVEPTSGNTGIA 48 14 29%
4538 LLN-24-GGG LLNEPTAAAIAYGLDSGQEGVIAVYDLGGG 34 22 65%
4539 GVI-29-LAI GVIGFTRLTLATELTIAQRDHLISIERSANNLLAI 40 7 18%
4540 VSG-25-IGG VSGLLGKTTESGVKAFGLITVGNGFIALIGG 41 4 10%
4541 RIL-24-ADL RILDLVKGVYAIILAALAADGVAEDIKADL 38 5 13%
4542 FLG-25-ALI FLGMMYYFVPKQAERPVYSYRLSIVHFWALI 43 13 30%
4543 LLL-26-IVA LLLVALATVTLIGALARLLLLAALGAAVLIVA 63 7 11%
4544 ALI-29-LAE ALIAYSDLLKGRVKLRLNDSHLLIELDTLIEVLAE 55 16 29%
4545 DLL-27-VLL DLLLLDVLTPLLDGLLAELFAFRAGPGFTDVLL 59 2 3%
4546 LGV-24-VLV LGVDPRKADQQVRGAVVLPHGTGKTARVLV 64 15 23%
4547 AAL-24-LIE AALKLKEISYIQAEGFAAGELKHGTIALIE 56 13 23%
4548 GLI-29-AGI GLIAPVAIIANLDLIVGFISKLPGAAVSLPGIAGI 48 17 35%
4549 FLL-24-LFG FLLAIMESVYVLTGKQIYKDMTKFWGKLFG 41 16 39%
4550 GAI-25-ITA GAIHSVVFFGFSPSALAGRIKDAGSKNVITA 37 16 43%
4551 VAI-25-AAL VAIVRLVAKPIALLVLGGAAGAAVALLEAAL 72 3 4%
4552 LDA-26-GVL LDACITRLRFEVPTADKVNEAGLAVLGASGVL 48 13 27%
4553 LDA-27-IGV LDAIAAVVLGGTSLAGGAGTVKGTLIGALIIGV 37 16 43%
4554 IGS-27-IGL IGSILIAAGEPLSLGITNFALAVMASRLFLIGL 40 7 18%
4555 LLD-26-GIL LLDEPFAGVDPIVVADIQDIIRILKSRGIGIL 44 13 30%
4556 LSG-25-FGL LSGFGFWSHDIGGFLNAAPAHLYKRWCAFGL 42 8 19%
4557 IAA-26-VSL IAASQAVVLFLAAALLSEATLLGAAAATLVSL 47 5 11%
4558 DVL-25-AIL DVLDPALLRPGRFDRKVLVGRPDVKGREAIL 40 17 43%
4559 LDG-24-NVL LDGGEGSNRLEGGAGNDVLKVSYWSADNVL 30 22 73%
4560 DVI-27-ASG DVIYAAHALREEGIAHVVISLGGRGLLVGNASG 33 6 18%
4561 VLF-27-LVI VLFMVLADEGRGAGDDMIIERLKAAKIPVILVI 35 9 26%
4562 GLL-24-ALS GLLSGPLDGGLVGVTGGLSRLGGIGLAALS 74 6 8%
4563 LGG-27-SLL LGGAVTGLGTFLNLIVLGSSLAAGLDGMAVSLL 58 9 16%
4564 LDA-25-LLD LDALRAAHARGAAVLLRLALIGLLEAAALLD 59 3 5%
4565 ELL-25-LLP ELLSEALAAAREIQDEYYRAYALSSLAPLLP 50 15 30%
4566 LLE-25-LEA LLELTVAALALAINVEESLAKELVEEIALEA 63 6 10%
4567 LLE-27-ADL LLERADFLFLRALLSSDSDARKLRFLSARLADL 53 6 11%
4568 GLL-28-VGL GLLFGFGIVLLGGILTGLMGRLLEGQVHAWIVGL 68 8 12%
4569 GLL-24-GIE GLLTFGIPAFKLEKEVMTRRREIFTGMGIE 40 15 38%
4570 AIA-27-SLL AIAEGLAWRIVRGDVPEVIADGTIYSLDIGSLL 71 12 17%
4571 LSA-27-LGV LSAALTILFALPLGGSLASAAVALARAASELGV 59 7 12%
4572 VLG-29-EVI VLGGLGSPLDGIGPVDLRIEGLLERVILLIIKEVI 36 10 28%
4573 ILG-27-LLA ILGLVAGLFGGLLDNVIMRIVDILLALPSLLLA 65 10 15%
4574 LIE-28-ALE LIEDLGLEQGIDLGKLATKLFGVAAAEGIEAALE 47 3 6%
4575 DAL-24-VIE DALKHPNWSMGDKITIDSATLMNKGLEVIE 37 10 27%
4576 SGL-24-GKL SGLQYRVVEQGEGAGPAPTDRVRVHYTGKL 40 15 38%
4577 GEL-29-AIT GELTIGNYMGALRQWVNMQDDYDCIYCIVDLHAIT 31 13 42%
4578 TGL-24-VLD TGLSGSGKSTLANAAEIKLAERGIALYVLD 35 13 37%
4579 GID-27-LLI GIDVLGAGWDSNAIGADVKIALLKAVANELLLI 37 6 16%
4580 LLS-25-GVI LLSAIGKVAAAIQYIPVVVMGGVSLGLFGVI 46 9 20%
4582 LGG-24-FLG LGGGTFDVSVLEIGDGVFEVKSTDGDTFLG 41 17 41%
4583 VIV-27-GLV VIVALLAHLTVPAAGAVAGFSAVAVAAVGGGLV 41 5 12%
4584 IAD-24-LLL IADVVALGASAALVVLGRASGGAISGLLLL 48 2 4%
4585 ALA-27-FLA ALAAGGAAAARLALLLLAIASTDGSAFLDAFLA 67 6 9%
4586 LTG-24-SVV LTGLFNGELFVHRNMAKARIGADINCSSVV 36 19 53%
4587 EIA-24-LLP EIADAVYIEPLTDEFVSRIIRKERPDALLP 37 12 32%
4588 GSG-26-DVI GSGKSNITDALRWVLGEQSAKSLRGGKMEDVI 37 24 65%
4589 LLP-25-GLF LLPELLGTWFKAELLPNIQFFLSSILCLGLF 38 10 26%
4590 IAV-27-LLA IAVPVSFGIALFLTELLPLWLFAPLGIAIELLA 72 16 22%
4591 DLI-29-LGG DLIIEAKSVAGGLTLSGVIGRAEIVVLLVGTFLGG 39 16 41%
4592 LGV-29-LGA LGVALPVVQRQGAARIVVELPGVQDTARAKEILGA 71 13 18%
4593 LEL-27-LAL LELVGLEVRELLLIASKVGLDLQEAKGALALAL 62 4 6%
4594 GVL-29-LGV GVLGTVNAVGTVARLGVLGVLGRVAGVATITRLGV 63 15 24%
4595 AAI-29-SLL AAILSPTDPVAVLAITGISLLPKSAMAILEGESLL 57 11 19%
4596 LLR-28-VLL LLRALLADAALGLQRLLLTLAVLAVDGVSLRVLL 64 8 13%
4597 DVL-29-ALA DVLTYAEAIGLGLLGASLSAAGTGLALAAFLQALA 74 5 7%
4598 GGI-28-DIL GGIGVMNIMLVSVTERTREIGIRMAVGARQRDIL 31 19 61%
4599 EGL-24-SLV EGLAQKIVDGDVPEKLQDKQVIRLDVGSLV 40 27 68%
4600 GGS-28-VGI GGSPTAYDRVLASRMGAYAVELLLEGKGGRCVGI 34 25 74%
4601 LLK-29-LTI LLKKVEKAVESGDKKPIKTWSRRSTILPNMIGLTI 41 21 51%
4602 VLS-28-LLS VLSRFRSGKEQASGLLGVAKGQFDIIIGTHRLLS 59 10 17%
4604 LGA-26-ALS LGAAGLLTFLAIALPRVVLALLAGGLLAFALS 70 9 13%
4605 VIA-26-ILD VIAIALACEPKLLIADEPTTALDVTIQAQILD 34 17 50%
4606 RLL-26-EVL RLLLDKLSMLNDNALELDAPAQHLDIDSKEVL 57 10 18%
4607 GAL-28-VLV GALVALFLLDALSAALLFPGRAALILGLLGGVLV 68 8 12%
4608 GSG-25-IAL GSGKTEVYLQAIAEVLSQGKQALILVPEIAL 41 23 56%
4609 VLD-29-ALT VLDLNLRPVALGVAGELYLAGAGLARGYLGRAALT 39 15 38%
4610 PLL-25-ELA PLLQRLGIRALAAKGNLPVRALAATPTRELA 54 9 17%
4611 PLL-26-VSL PLLLMGGLVGRLFREFAVTLSVAILISAVVSL 46 23 50%
4612 ASG-28-TLA ASGALYGVLASVFSSTGTGGGIEGTITSTITTLA 50 7 14%
4613 LDV-26-DAI LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAI 32 9 28%
4614 LDG-29-EGL LDGLETVISGASCTTNCLAPMAKALDDEFGRVEGL 35 11 31%
4615 GVV-26-LLA GVVEGVGAFAAVGRLALVLLLGLDGDAGALLA 75 6 8%
4616 DLI-26-ILV DLILLDINLPDANGLMLTLILKLGSGVDIILV 34 6 18%
4617 GIS-25-GID GISPREALAMDPQQRLLLETSWEAFERAGID 31 25 81%
4618 ALI-24-LLP ALIAGIGLAPAEILGALKTFAPLERRALLP 52 6 12%
4619 TLI-29-VLL TLIETFGLKHVQWALLLAAFRVGIALFFEVGFVLL 45 15 33%
4620 IPL-27-AAI IPLTAGGVGLIIKDFDWLLELGADKANRNKAAI 38 15 39%
4621 LGL-27-GAI LGLGDIAAFPGHIAPDKRNIQDGVRLLEALGAI 61 12 20%
4622 ALI-26-LGA ALIAGAVALALLLLAALIGRALAAATAATLGA 68 4 6%
4623 ILL-25-LAI ILLFLYLGLIGLLLAVALRLQAAAALAVLAI 63 9 14%
4624 LGV-28-ILG LGVAEPLVQRQGADRIVVELPGVQDTARAKEILG 52 18 35%
4625 SGG-27-DAI SGGMQQRVAIARALAIEPKILLLDEPFSALDAI 33 27 82%
4626 DLA-26-VIA DLAVLIGDVEAVKAVADLGDSAKVRVGDGVIA 45 8 18%
4627 IGS-27-ISA IGSGVDYAHLEQVCGAMVRQVLEFGQDIEAISA 32 11 34%
4628 YLL-26-GVI YLLPLLIGYTGGKLVGGERGGVVGAITTMGVI 32 19 59%
4629 VGK-25-LSL VGKTAIVEGLAQRIVNGEVPEGLKGKRLLSL 37 22 59%
4630 LLL-29-IVL LLLLADLAGLLSSMVTIELAGLLGVLLGGLVAIVL 83 1 1%
4631 LVL-29-LLI LVLLAHLFINIFAGGFAGVDAFFTFLLALITGLLI 66 8 12%
4632 LVA-29-AGI LVALLSLLARLALAAGAPADVVLAIIAAALFPAGI 61 8 13%
4633 ALI-28-VVL ALITENSTLPGTSIYMKTVDLEDAVKEGAADVVL 59 21 36%
4634 LLK-28-VID LLKDINATLGVTVHYKTGEEDVLLIILDTVAVID 37 9 24%
4635 GIG-29-GVL GIGFAGGGNRALEAAGVAISSPLLEASIDGAQGVL 46 14 30%
4636 LVD-24-ILV LVDAGLSGKKMEELFAEIDRNIQDLNGILV 34 8 24%
4637 VLT-29-GAG VLTGGGDTLGRDGTEARRALGGFAGGILLVVIGAG 45 14 31%
4638 GVG-29-IGA GVGSTGLLIADLHGGVVPDIDTIAKQLGGGFPIGA 48 9 19%
4639 LEV-26-NAL LEVLRQDYIRTARAKGLSERRVIFVHALRNAL 32 26 81%
4640 LDG-25-GVV LDGTKEFIKRNGEFTVNIALIEHGEPVLGVV 36 22 61%
4641 LLI-24-GVG LLIPMVDLAELARAVVSATRYPPLGVRGVG 40 11 28%
4642 AGI-24-LLL AGIVAGLPSAIALTIEQARQGDLHILLLLL 75 14 19%
4643 KLA-29-AIE KLAEGLYTWLPTGYRVLLKVENIVREEMANAGAIE 38 9 24%
4644 TLA-27-LLT TLAQIIAKELGVNLRSTSGPVLAKAGDLAALLT 60 18 30%
4645 AIG-25-LVS AIGVHHMEGHLLGPLLEDTKPEVPFVALLVS 42 8 19%
4646 IAV-26-LSV IAVGVALVGCGPGGTLSAVMTYLAAGLVALSV 44 9 20%
4647 AIE-25-IAV AIEMAKEAGYTAVVSHRSGETEDSTIADIAV 33 24 73%
4648 TLI-28-GVL TLIAVHGENDPKGEGMAIAKAWAAATGGHRAGVL 40 13 33%
4649 DIL-29-NAL DILKSLRIRSRGINFIACPTCSRQEFDVIGTVNAL 32 12 38%
4650 GLD-28-LTG GLDYLTLSRAASTLSGGEAQRIRLATQIGSGLTG 50 22 44%
4651 NVL-26-GLA NVLVCTTIIETGIDIPTANTIIIERADRFGLA 39 24 62%
4652 LLD-27-SAI LLDEVEPLLLVEVRASLHGERPMALGTGSESAI 35 6 17%
4653 ALS-27-SLG ALSLNTAAYIAEIVRAGIQAVPKGQMEAARSLG 50 21 42%
4655 LEL-29-IGA LELKLLADVGLVGFPSVGKSTLLSVVSAAKPKIGA 38 14 37%
4656 SLG-29-LLN SLGLLTINALTAADSVLIPVQCEYYALEGLSQLLN 37 15 41%
4657 GIG-29-GSL GIGVTAMLVALNGWLLLKASLETALTAGLWLAGSL 45 14 31%
4658 EIA-24-DLL EIALEGNPDAHARLDPSFRNGKEVFLRDLL 39 6 15%
4659 IVA-25-ALV IVAAVLGVLKALGALGLAPEVLGGLIGAALV 53 11 21%
4660 IEA-25-AGL IEAALALTLLAGIAGWAERAFLLEARLLAGL 53 7 13%
4661 DLV-28-GAI DLVEINEAFAAQVLAVLKDLGLDLEKVNVNGGAI 35 19 54%
4662 DLV-29-LAT DLVKNQDGAVVGCTAICIETGELVYFKAKATVLAT 40 15 38%
4663 GVS-29-AIT GVSHVINDAIPQDLSFFVHRVGRTGRNGLKGTAIT 31 17 55%
4664 LDG-29-LTL LDGSDLYQSIAAIFGAQLYGIDLSIQQEILLVLTL 40 12 30%
4665 VSL-25-LGL VSLELEPGEILGLVGPSGAGKSTLARVVLGL 62 24 39%
4666 LGL-27-LSV LGLLVNPSDLLPIAAPALILAAIMIAIARPLSV 59 13 22%
4667 LAL-26-VLT LALMAGGVPIKAPVAGAAMGLISDGTNYTVLT 66 15 23%
4668 LSG-28-DLA LSGGQRQRVLIARALAQEPAILLLDEPTNFLDLA 53 22 42%
4669 VLA-28-RLL VLAACLLADCCEAWLDVDLVYLALPRLVPDARLL 76 11 14%
4670 ALV-29-AIV ALVALATAILEFALYLLIPQLAIAALAVEVPAAIV 54 12 22%
4672 VIG-24-VIL VIGDGAITAGMAFEAMNNAGALLADMLVIL 43 20 47%
4673 IGA-25-IGS IGAGAASGGQMDASNLIKPLLSSGKIRCIGS 41 23 56%
4674 VAI-24-IVA VAIGQKGSTIAAVGRALEEMGALTYTTIVA 40 12 30%
4675 ASG-26-AIV ASGRAIASDCADGMTKLIFDKETHRVIGGAIV 44 17 39%
4676 VGI-24-AGI VGIVGVMPVNQSIYDALTVLQHRGQDAAGI 42 20 48%
4677 LLV-27-VLN LLVVDASQGVEAQTLANCYTAIEMGLEVVPVLN 38 29 76%
4678 AIL-24-GVG AILSGMSPGGFAAAIELEDISKLVKFPGVG 38 10 26%
4679 DVL-26-ASL DVLLCSNLFGDILSDECAMITGSMGMLPSASL 40 11 28%
4680 VIA-28-AVL VIADAGTKVVGDVDGSLTAQVFGLINGDTDAAVL 60 14 23%
4681 AIV-25-IEA AIVPLTVGAAPFIARLVENALLEVDAGLIEA 36 17 47%
4682 LLP-29-EIV LLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIV 34 25 74%
4683 LGS-27-YGL LGSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGL 33 26 79%
4684 ALN-25-PLL ALNSIWMSLGWRVPLGSFALDDLQLILLPLL 34 6 18%
4685 LGI-25-LSL LGIDNLVFIAILAGKLPLIVLDLARLIGLSL 64 11 17%
4686 LEL-26-ALV LELVDLDGAEALGPGQLSGGQAQRVALARALV 49 12 24%
4687 LEL-27-VLG LELTGTTGTRLYLLAGHLGQVLDREALSVEVLG 45 7 16%
4688 VVL-25-LIA VVLGSLLGSVALGIAGGATALGGAMFLALIA 54 13 24%
4689 GIG-29-GLI GIGFGATVKSKSDKAGVGELLAQVEPEDLIKFGLI 44 22 50%
4690 GSG-29-LLT GSGAFMLTLEASRLLAIASVGVANDAGVGTTALLT 41 10 24%
4691 ALT-27-SAL ALTPQLFRVELLIDCLGSAAAAGAAITDEASAL 57 12 21%
4692 ALT-27-GAL ALTALIGSYEVRAALALGAALGILAIAAIAGAL 67 8 12%
4693 IGG-25-GIE IGGLKEVIEKIREMVELPLKHPELFERLGIE 34 24 71%
4694 ATL-27-LTG ATLANAIALGASQTGLDAAVVLLLSLLALSLTG 50 6 12%
4695 GIS-27-GLA GISEEDLPRIFERFYQADSSRSRRQGGTGLGLA 48 27 56%
4696 GAS-28-GDL GASYQLAVELREVDYRQLSRQLPGFYMRTRTGDL 35 12 34%
4697 GDL-26-LIE GDLSQKVDPYLRPLYDALFEMLGFEKVEKLIE 34 19 56%
4698 ELL-25-LAT ELLEGLALGIAVVLVTLLMLSYVLFGGSLAT 49 9 18%
4699 LLE-29-IVS LLEVAEQGADYFTIHIAVGLRYVLMEAKRGTGIVS 37 9 24%
4700 GLG-29-LVA GLGKMTMAAVIANELGVNLAQTSGPAIEKAGDLVA 62 11 18%
4701 ALK-26-ELL ALKEQGKKLPEYAQVGLESPREARPIEVKELL 56 7 13%
4702 VAL-25-GSG VALGAAGLGYAVGFDLAKALALLRAGATGSG 49 11 22%
4703 IAA-27-AGI IAALIALILSALTGFKLAKLTGAILKALLVAGI 58 8 14%
4704 LEA-27-GEL LEAIRQVRLELGRENAVFIHLTLVPYIAAAGEL 48 20 42%
4705 AAI-29-AAI AAIARAKARKLEQQQANAEPEEQVDPRKAAVEAAI 65 18 28%
4706 GSG-28-DLL GSGKSLTALAIMGLIPDNGRVTADRMRFDGIDLL 42 27 64%
4707 ELI-29-VLA ELIPRQQFDVPIQAAIGSKIIARSTIKALRKNVLA 45 21 47%
4708 ILD-24-IAD ILDMRLRRLTGLERDKIQSEYDDLLALIAD 33 13 39%
4709 LIA-29-LVL LIAAELTEALDVVIVAQIGELALELQLKENMALVL 67 12 18%
4710 AIA-26-ILA AIARALANDPKILISDEATSALDPATTAQILA 66 18 27%
4711 LVE-27-LAE LVETGALGLAPEIARGGLNEPLAVEEDAGLLAE 64 12 19%
4712 LLR-28-GLL LLRFDLSEYMERHTVSRLIGAPLGEVGFDQGGLL 64 13 20%
4713 LGF-25-LAA LGFTQLKNRVLMGSMHTGLEESGLGLERLAA 62 13 21%
4714 VLL-25-ELG VLLLDEPASALDPKLREQLGDELKRLQKELG 56 27 48%
4715 ALS-28-VIG ALSTLLEVRVHRAGKIHYQEFERGVAVADLGVIG 49 14 29%
4716 LAI-24-IGV LAIRLGARLGGIGIAFAKLLGVLGAAAIGV 45 7 16%
4717 SLA-28-GIA SLAAVLWADLTESVPAFITAVMMPFAFSIGEGIA 52 11 21%
4718 GLV-29-LLT GLVVLMDIRHPLKDLDQQMIEWAVASVIPILVLLT 54 17 31%
4719 VSL-24-LSG VSLAVGAGELLGLAGANGAGKSTLGKLLSG 50 16 32%
4720 IAG-26-SLL IAGVVTNLLLRGKLFGIILLALLGVAAVVSLL 51 6 12%
4721 DIL-25-EIL DILDPALLRPGRFDRLIEVPLPDEKGRLEIL 38 15 39%
4723 LLI-27-LSL LLIALLFTALFALATLLAIALFPIQLLLVSLSL 69 6 9%
4724 AIA-27-LLT AIAFGLIPILLAAFGPTLDREVGKLTTDAALLT 59 6 10%
4725 LAK-26-LAL LAKGHPGAQIRDLALSKARFEFRWEDQFNLAL 64 13 20%
4727 LAE-27-EAI LAEGEDALVLTAIDASGAFPGDYELEENLSEAI 56 12 21%
4728 VLV-29-ELL VLVLTRFDTILEAVDAARAGAAGYLAKRGAAEELL 59 12 20%
4729 GLV-29-LIA GLVLLASLGSHTVARVWLDGYLDNADKEALEDLIA 56 15 27%
4730 VLI-25-GFL VLIGINLLREGIDLPEVSLVAILDADKEGFL 36 17 47%
4731 KLA-28-RLL KLASELHKRSTGKSLYILDEPTTGLHADDIARLL 39 22 56%
4732 EIL-25-GEI EILGIAGLSGAGKTTLLRAIFGLDKPDAGEI 37 22 59%
4733 VLT-27-DAL VLTRVGGRLRVLELLLAGIGGKAFDVLAERDAL 43 10 23%
4734 GLD-24-LVS GLDPDISTIFIQSQIPEAQELSMYALNLVS 39 9 23%
4735 IEL-29-ALK IELPIKSSFREGLTVLEYFISTHGARKGLADTALK 39 14 36%
4736 LVL-25-LPL LVLTVTQMLRKHGVVGKFVEFYGDGLALLPL 64 15 23%
4737 AIL-26-SLL AILLIGIVVASLGLALLGEAIDEDLIVIHSLL 62 6 10%
4738 LLN-29-ALL LLNLVIFLSKKVGLLANILIGIFAAELLGLSGALL 61 2 3%
4739 LVL-25-LID LVLSDYAKLALASVRLMILLARKAGVPVLID 43 10 23%
4740 LLI-29-SVL LLILDEPTIELDVLALSDILNFIVGLNGSGGTSVL 47 17 36%
4741 VVL-27-TLG VVLGAGPAGYSAAFRCADLGLETVIVERYNTLG 44 15 34%
4742 IAS-26-TLA IASEFRYRKSALRPNSLLITLSQSGETADTLA 46 21 46%
4743 NLL-25-GAL NLLLLDEPTNHLDLPLRLALYWALANAEGAL 41 11 27%
4744 DLV-27-IAA DLVASSFAVSAKLLAAALELADILGVSAGVIAA 45 7 16%
4745 IEL-27-VAI IELKKDADSELILNYLFKNTDLQINYNFNMVAI 31 16 52%
4746 SGV-24-VLG SGVLDLARARTQALLVLLLVPAGSGTTVLG 41 2 5%
4747 GID-27-LVV GIDADIPPLEVDGGIVTTAEAIIAASFHGPLVV 34 12 35%
4748 LLL-28-LGF LLLIGGLFLAFLLLGAGAGLAIAIAALLLVLLGF 64 6 9%
4749 ELL-29-LLD ELLAEFPAALKQLIDLCAASPMIASQLARLPLLLD 68 13 19%
4750 LSG-28-AIA LSGVFAAFAGALLAGRIGSATPNAGFGYELDAIA 66 20 30%
4751 ALG-25-ALE ALGLATPTAIMAGTGRGAGNGILIKNAEALE 65 26 40%
4752 ILL-27-VAI ILLIDAFKGLLDQQRKESFISILLGIEVLVVAI 44 7 16%
4753 LSA-28-LSA LSAVDAKTEHAILENLRQERQGKTVIISAHRLSA 70 20 29%
4754 KLA-26-LNA KLAGGVAVIRVGAATETELKEKKLRIEDALNA 37 20 54%
4755 EAI-29-IGV EAIARNLREMSRLKVPVICTVIGEGGSGGALAIGV 31 23 74%
4756 VLD-28-SVL VLDTWFRSALALFTTLGWPEMTLFLGSGVPKSVL 36 18 50%
4757 IGG-28-GGI IGGGASAIVMAAALVLVLSDPAVKSVFINVFGGI 47 17 36%
4758 PLL-25-LVS PLLLVGGLAGRLLAEFAAVLSLAGLISGLVS 44 8 18%
4759 LGF-24-DLV LGFGASGISIFARVGVPIFRKDIDIGADLV 30 14 47%
4760 VVI-26-VLV VVIGGRNGAGLTLALGLNAGSVLLEAGLPVLV 46 6 13%
4761 VGI-24-IAV VGIVVIGATGVHFQTGFIEMAQAIPALIAV 35 12 34%
4762 VIE-27-VSG VIEVEGTVIETLPNAMFKVELENGHQILAHVSG 35 21 60%
4763 LLE-26-LVI LLEKLRFEPETARELGGGAIKLAEGKRNPLVI 40 11 28%
4764 LVL-24-VSL LVLLLALLLNVLFLIRSAVKVKLENFSVSL 67 11 16%
4765 LIA-28-VSL LIALELLEGGIAARGIALAGALFVVLFAEGVVSL 54 15 28%
4766 LIE-27-LAT LIELLFGLNYHIAVVLVGVLMLLYVLFGGMLAT 39 9 23%
4767 LPL-28-LAE LPLALLALGGLLALIVLLEPEALAARLAARRLAE 54 6 11%
4768 NLL-24-LVA NLLGQNVNAYRGENYDGEIGSFAELLRLVA 44 13 30%
4769 SGV-24-AIS SGVDYNHLEFVCCAMVPQVEEIGDDIRAIS 32 11 34%
4770 ALS-26-GLV ALSGIVLRLRIPKGILGILQVEALANDASGLV 59 9 15%
4771 LGL-24-IVG LGLGLIIVPGSFLSVLPTGLDSTLALKIVG 54 5 9%
4772 LAL-25-SVV LALLLTTAGILLALEGAANVQLALAALRSVV 54 8 15%
4773 GLL-25-GLV GLLAGGISAALSLAFGEFGASVLNALLLGLV 74 7 9%
4774 LLV-25-GDL LLVALLAALLDLAQDAKVAKLKDMVLALGDL 40 4 10%
4775 GLG-25-LLF GLGLLTPIFSPGGLHHAMANDDAVALGLLLF 55 9 16%
4776 VLG-25-ALS VLGVVLAAAGVALLAITVAAVGALLFGFALS 60 4 7%
4777 AGI-24-VGK AGIVENLELYNSDAEGKLAVAIGRSNIVGK 33 16 48%
4778 LIV-26-VIA LIVTGALVGSSGAILSYIMCKAMNRSFISVIA 42 17 40%
4780 GGS-29-EIV GGSLTIIATALIATGSRMDEVIFEEFKGTGNSEIV 31 11 35%
4781 LGL-27-NVL LGLVVSLALFVVAAPTIAAAAPVVGGAFASNVL 38 3 8%
4782 GAG-29-SGL GAGMFALPAAAAGAWFLASELALAATWFCMLTSGL 51 21 41%
4783 DLV-27-GLS DLVDAQQARRILDRLVGYNISPILWKKVKKGLS 40 26 65%
4784 GFL-24-LAS GFLLGGTALRTLLAGAGLDHGDGGLLALAS 37 6 16%
4785 LVF-27-GLG LVFSDYARNAVRLSALMGAPVIYVWTHDSIGLG 38 15 39%
4786 LVV-24-VLA LVVALIFLALILAFVTAALSGKLQLAAVLA 66 7 11%
4787 DVL-27-FLA DVLQGKVAVDSEVTVRGWVRTRRDSKAGISFLA 35 11 31%
4788 GVS-24-IPL GVSKILSLTKVWLTVSRAFESESEAASIPL 31 11 35%
4789 LLL-27-IAV LLLFEGKLGLLLAVAVLVLSGVVLLVVGQGIAV 67 4 6%
4790 LLL-24-TLI LLLDEPTNHLDLDAVIWLEKWLKSALGTLI 63 12 19%
4791 TLL-28-RLI TLLVAAQKDLEISILDLLSGLFKLFLSKLDWRLI 41 7 17%
4793 GVL-29-GVL GVLSSKGGEVAILLTLGVKAGLLAAAEAAKLTGVL 59 4 7%
4794 VSL-26-GLD VSLIVGAGELPALQGPSGSGKSTLLALLAGLD 39 18 46%
4795 AIG-24-VAL AIGALALTLLGLSAAIGLIAAVGIAFAVAL 59 5 8%
4796 GEI-25-DLL GEIGKNTYGIEYLDEIIIEDAGIKFPEDDLL 43 10 23%
4797 DAI-26-TGL DAIGRITGRGKAAGIHLILAFHRKRVDAKTGL 33 13 39%
4798 EIV-25-GSI EIVGIAGIDGNGQSELIQAITGLRKVKSGSI 29 13 45%
4799 LGI-25-GIG LGIGLPGLVAIAIPLVVALRLVLGALAFGIG 52 3 6%
4800 LTL-27-GAS LTLAAVHTLGIPVDLPTALLLSVVAAVCACGAS 42 21 50%
4801 ALK-24-GEI ALKGLAASLMKIANDVRWLASGPRCGIGEI 38 14 37%
4802 LDL-24-IAG LDLTINNGEFLALLGPSGCGKTTLLRLIAG 39 19 49%
4803 GVL-27-FGL GVLFGGIIVGHFTGGAGLTLSGDMLHFIQEFGL 40 9 23%
4804 AAI-27-VGI AAILVLLGTILLPGAGLSDNAITLVLIAGLVGI 41 6 15%
4805 LVV-28-GIV LVVHPGAGNPDGTVLNALLHYYPAILDVPRAGIV 44 14 32%
4806 DAL-24-GLI DALTIYIVAIIFGSLIVSPDVGLVKAGGLI 46 10 22%
4807 GAG-29-LAK GAGGLGLLALQVAKALGAAVVIAIDINSDKLELAK 48 20 42%
4808 GSL-29-LVA GSLKARFCLAGNEATKAFCAQNGIRVENCGKLLVA 51 16 31%
4809 IGV-26-LLS IGVMYLGKLVELATSDDLYNNPLHPYTKSLLS 48 18 38%
4810 LEV-26-AIA LEVFFISGKTLTELTQTKGDALPYQVHQFAIA 39 13 33%
4811 IVV-28-VIA IVVLENIFRHIEEGESPRAAALLGTREVAFAVIA 39 19 49%
4812 VID-27-ELL VIDGRGWRSGAKVEKREIPQWFLKITAYADELL 41 21 51%
4813 LAL-24-GFL LALAGGILGLALTAALEGSGLLALFALGFL 59 6 10%
4814 LLS-29-GVG LLSNAIRFTDLGSAVLHVRALGDLLSIRVRDLGVG 47 8 17%
4815 LTL-28-DAL LTLGLAAGLLPDEVALRGLDIDLEQAFRELIDAL 49 18 37%
4816 LTL-28-ISA LTLAESTPGVALQPGLAIELIAAPRFQDYAVISA 39 14 36%
4817 LAS-24-LLT LASSPFDSEGVRTSQRDITRDGVLTQFLLT 55 12 22%
4818 GLS-25-LAT GLSAADVDVVEAHGTGTTLGDPIEAQALLAT 53 17 32%
4819 VLG-27-SGI VLGCAFQAVAPLIRIGAQVGSDAMEGALIASGI 37 14 38%
4820 DAL-25-GAG DALFCSKVAKVVKSNADVAAKANMLIGIGAG 58 10 17%
4821 LTG-29-GVG LTGVVLTKLDGDARGGAALSIRHITGKPIKFIGVG 58 35 60%
4822 IDL-25-NLL IDLEVKPGEVVAIIGPSGSGKTTLLRCINLL 33 23 70%
4823 NAL-24-LAE NALYGALLLIDEGDMSRMRAGLVAGNTLAE 52 8 15%
4824 FGL-24-VLE FGLRNVTDKDRALRSMYRVLKPGGRLLVLE 31 19 61%
4825 LDG-25-YGL LDGMEITQFTYFQQVGGLATEPVTAEITYGL 30 20 67%
4826 IPL-26-FGL IPLMAVPVSLPGTFAVMHLFGFSCNALSLFGL 34 13 38%
4827 LLS-27-AGI LLSLLSPAVAGAGGTSVSSALTLVAELAIIAGI 55 4 7%
4828 VLD-29-ALA VLDAAAGTGARGVALRTLGTEAGHIDEDIAAGALA 69 7 10%
4829 FLG-27-LLL FLGLAVALSSPQLDSGLTLAGLAFGSLGGSLLL 63 7 11%
4830 LLV-25-ILV LLVPTTLMGLSGKAVFAMASFNRIDLDEILV 48 8 17%
4831 GIG-26-VLD GIGLMGIPIGKLGLITACLGELPAYTLPNVLD 40 12 30%
4832 LLF-25-LSA LLFIFTKLLLGIRSKLLLSLLFCVAAAFLSA 46 13 28%
4833 AKL-25-AIA AKLLRDVGLLTGATETKLQGSAGGGVIVAIA 46 6 13%
4834 GAI-28-VLV GAIGIRLALKVEMTEMPELVAILHSFVGLAAVLV 44 11 25%
4835 DLV-25-VLA DLVECAVLTDLLVAGNIDNLTAPLLPLDVLA 49 8 16%
4836 VLT-27-NAL VLTVLHAGGKFDKDSYKVSGGLHGVGVSVVNAL 34 22 65%
4837 ILD-26-LVG ILDIFAMRARSHEGKLQVHLAQLKYLLPRLVG 35 11 31%
4838 GGS-25-AIA GGSGKQARSVIDGIEADVVTLALAYDADAIA 50 15 30%
4839 IGS-25-LLD IGSPPGYVGYEEGGQLTEAVRRNPYSVILLD 36 20 56%
4841 ILL-26-VLT ILLVLDSMTGQDAVNLAREFNEQLSITGVVLT 44 15 34%
4842 AGL-26-LLF AGLFGGALNLALLGRSTLIALVALGFGDGLLF 63 15 24%
4843 VLS-26-GVV VLSVKMQDPQFAGQTKERLSSRQRAAFVSGVV 45 15 33%
4844 LGG-29-LAI LGGFGGLFDLSQLGVKEPVLVSGTDGVGTKLLLAI 55 14 25%
4845 ASL-26-LAE ASLSKILVAAVLVTVVHSALGAINEDDVTLAE 62 9 15%
4846 LEL-29-SLA LELLAIQAYAKAVAPRGGAALLVAALKTGVFGSLA 47 8 17%
4847 LVS-24-ALG LVSGGAAQLTLLLGLLDYALLGTLALAALG 59 2 3%
4848 GIA-29-LAS GIAIYDDEKGLLANQLYSQVKLHADYGGVVPELAS 48 12 25%
4849 GIL-26-LGG GILADGVNEIAAGLNPLIVGNLLLAIGGSLGG 47 13 28%
4850 ELV-25-SGL ELVVAALAANIAVILLPGANAGLTALIASGL 38 13 34%
4851 NAL-24-VLA NALWIVVAAVCVDLLAYRFIGLYILKDVLA 43 6 14%
4852 DAI-26-IGV DAIAAVVLGGTSLAGGAGYVKGTLIGALIIGV 31 17 55%
4853 IAD-26-ADL IADRLEVGGGIAATAEAAEGGKVGRSLYEADL 42 11 26%
4854 LGT-27-IVA LGTTNSCVAVMEGGKPKVIENSEGDRTTPSIVA 38 20 53%
4855 LDG-29-VLV LDGIAILAEKDEELYHAAAAHVVLLLHPNPADVLV 39 7 18%
4856 FLG-28-AAI FLGLAVLTIIVSALLMVKALFMALGEPTLDIAAI 38 13 34%
4857 GFL-29-RLI GFLLKDTSPDELLEAVRVVAAGEALLAPGVTRRLI 31 17 55%
4858 VLL-24-LDL VLLVTHDVSLALAMADRVLLIEEGGIGLDL 51 9 18%
4859 LGI-26-GSL LGIAVDAPTAVLLSLVAILGACGASGVAGGSL 42 11 26%
4860 GAL-29-VLN GALLVVDAAQGVEAQTLANCYTAIEMDLEVVPVLN 35 25 71%
4861 LVV-29-ALN LVVDDHAGNRRLLADLLEQLGYQCKTANDGVDALN 36 12 33%
4862 IVG-26-VSG IVGTRDASEYGARVARKLAKALAKAGFLIVSG 36 13 36%
4863 IGG-28-LLI IGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLLI 46 19 41%
4864 VAI-25-LSL VAIGAAIQADILVGNKLDSEMLLLDVIPLSL 47 13 28%
4865 VEL-25-GIS VELILCRLHAGGKFSNKNYQFSGGLHGVGIS 31 15 48%
4866 GLD-26-VLS GLDPGAALLLFTLLGLGKGKGLAVECGAGVLS 41 12 29%
4867 VVI-28-AGI VVIVDELADLMMVAGKEVEDAIQRLAQMARAAGI 38 33 87%
4868 LDI-25-LAL LDIALGIGGLPKGRIIEIYGPELSGKTTLAL 43 11 26%
4869 YLL-25-LLE YLLPQFLSPIENLRTDAIGGSTENLARQLLE 38 9 24%
4870 VLL-27-ALS VLLLLAGLAALLLVLLALAELARVLLGLALALS 69 4 6%
4871 LGI-28-GLL LGIGLSRNEALLAAILAGAALLQTIPSLALFGLL 71 14 20%
4872 LLI-27-SLA LLIAEYAAKVILNSGYFKEGFSLQTGTGGASLA 56 15 27%
4873 LVG-24-ALV LVGLGGASKRYPAELSGGQKQRVALARALV 71 22 31%
4874 LLA-28-LVD LLASALVSVVLGGENPLLDKIALARERGAVVLVD 60 8 13%
4875 LIA-29-LDL LIAVGLSAQATDVGVNKATAGLYPVANTPQAILDL 53 12 23%
4876 SLA-26-PLL SLALGRDHQFIEPLHLMSALLDQEGGSIRPLL 53 19 36%
4877 GLA-29-ITL GLAVLLDQGGLLAGQGLACDLCYRVCDIIDEAITL 43 7 16%
4878 GIS-27-GLS GISKEDIKKIFDRFYRVDKARTREKGGTGLGLS 40 18 45%
4879 IVV-28-VID IVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVID 30 21 70%
4880 GIE-28-LAI GIEPDHLERLFERFYQADGSRSRSTGGTGLGLAI 34 21 62%
4881 GGI-25-LLV GGIGRAARRWECFDRIVEVLKRLEDDETLLV 44 18 41%
4882 VEL-26-ALV VELGGLLLVRAEGAVEAGADLAGAGGEAAALV 47 2 4%
4883 IAD-28-LGL IADNGAGIAEEVKQKIFDPFFTTKPVGKGTGLGL 46 17 37%
4884 GEI-28-GID GEIGKNTYGVEYQDEIIIIDAGIKFPEDELLGID 30 27 90%
4885 VID-29-LEA VIDPTEALTAIDINSARATRGGDIEETALNTNLEA 37 22 59%
4886 AIT-27-LLE AITAQIAKAKLPTHVEIFAKHYGLDKDSVILLE 36 14 39%
4887 LLE-25-LAE LLELLLGATPIGTGLNTPGAGSALAVKKLAE 77 10 13%
4888 LLT-29-GLG LLTAPPALEVSALPLLVAHESLILADVVLVGSGLG 57 14 25%
4889 ALK-29-LAL ALKQIEKDFGKGAAMRLGERAEQKVQVLSSGSLAL 61 15 25%
4890 GLV-24-LGV GLVGADAGRIELAGGDATAAALAALARLGV 60 4 7%
4891 VSL-24-LGA VSLSLAVALLEIRLDKLALAALAVAAVLGA 49 4 8%
4892 RLL-26-RLI RLLRADHPDAFLWLDFLIKDADLELRILVRLI 44 12 27%
4893 VGL-29-DVL VGLADKANAYPRHLSGGQKQRVAIARALAMDPDVL 40 29 73%
4894 LTG-29-VDL LTGARQRVGNWPGVTVEKKEGQFKTTGHQVTLVDL 37 21 57%
4895 VLD-26-GLG VLDMTVEEALEFFEAIPAIRRKLQTLVDVGLG 47 27 57%
4896 GKL-28-LEL GKLVLESPPFPLRDLLTNVLTLLAISSHNKGLEL 42 11 26%
4897 LDI-24-LSA LDIMMPKMDGFEVCREIREASNLPIIFLSA 35 19 54%
4898 GIE-27-GLA GIEPDHLPRLFDRFYQVDGSRTRDTGGTGLGLA 36 21 58%
4899 IVD-24-LIE IVDDGTLAGRRGSLNIDDEGTPGQCTTLIE 31 10 32%
4900 AIL-29-LSL AILLILLLFFFFFLLARILGLALLGMIALLVGLSL 59 13 22%
4901 LAK-26-LGL LAKRMGKPEIIAETGAGQHGVATALAAALLGL 55 19 35%
4902 IAA-24-AFL IAAVPYKIHTILTDNGIQFTHRKTDRHAFL 49 12 24%
4903 GIV-25-LAE GIVENMSIAICSNCGLHENIFKSGGAEKLAE 45 9 20%
4904 VAI-29-TLG VAIGAAIQGGVLGGEVKDVLLLDVTPLSLGIETLG 36 20 56%
4905 DIL-26-GLS DILVSTTIIETGVDVPNANTLIIEDADRFGLS 35 27 77%
4906 LFG-29-PLL LFGDLLAVSPLDLGFIEAGGALVGAVLAFLWRPLL 39 10 26%
4907 SVV-27-IAA SVVDKVVEKKATALLAEAYLKYLYSAEGQEIAA 44 8 18%
4908 LLL-29-GLF LLLGFGLGVLLVAFGASLAGRPAALLGVLSLLGLF 57 7 12%
4909 ALA-24-ELV ALAALLDLLLLDEPTTLLDASTQLEILELV 68 11 16%
4910 ILA-24-ALG ILALVFGLLLRIILVGIKAGALAGVMLALG 64 8 13%
4911 TIA-27-IVG TIAADNAIFGQTGPKVGSFDGGWGASYLARIVG 32 19 59%
4912 LLG-29-GAS LLGIALAAAAALLAAAALLAAPLLAALGGLALGAS 55 1 2%
4913 VLL-28-VVS VLLLDEPTNGLDIQSISWLEDFLINFENTVIVVS 47 20 43%
4914 LIG-24-SLG LIGANGAGKSTFLKILAGDIAPDTGHISLG 47 12 26%
4915 GLG-25-AIV GLGVMVVVGLVGADIFLGFVAGLAIVILAIV 60 14 23%
4916 IVL-27-LVI IVLGTSSSESALPRMLDKMEKLGCRKSVVGLVI 39 15 38%
4917 LLR-28-GLS LLRMEADLHDRVIGQEEAVEVVSNAILRSRAGLS 50 13 26%
4918 SLV-27-ILG SLVLTVARGLSRPANRNLPGGITLLFAICFILG 42 11 26%
4919 LAL-27-LLF LALSSTAAALQALAERFLLGSLLGRSAFAILLF 82 20 24%
4920 LSG-28-GIE LSGYELKIDLLKHFRELHSKTPGHPEYVLAPGIE 34 8 24%
4921 VAL-26-VGL VALALGAGLLADAILAGIISLLPLVAALAVGL 63 2 3%
4922 AGI-26-LGV AGIQADLKTFQLLGVLGMSAITAVTAQNTLGV 55 16 29%
4923 GIL-29-LLT GILIMVINIVGGLSIGMLQHGMSMGSAAEIYTLLT 44 11 25%
4924 SGG-24-GSL SGGEQQRVAIARALLKEPKIILADEPTGSL 38 29 76%
4925 IAV-29-LEL IAVNVSPVQLAHALFEFIVAIALAETGLAPTRLEL 34 13 38%
4926 VIV-28-AAL VIVAGAAGIAGLALVALALLAGADTAAGAIAAAL 57 11 19%
4927 TIA-24-GLL TIAILGVTGFPRMYDARKATLVAAIHGGLL 42 9 21%
4928 GFL-28-AIL GFLSGISLWDVTETVQGVKLLEPGLLGAELIAIL 40 6 15%
4929 LAL-26-GIG LALGALEGRLIAEVQQAALRSLFLLGVGGGIG 65 12 18%
4931 ELL-24-PLL ELLSEALALAREIQDEYDRAAALSALAPLL 52 12 23%
4932 GLA-29-VGK GLAVGEPKEDMHRILEHVCPQIPADKPRYLMGVGK 35 18 51%
4933 DAL-28-GLV DALAVLQAAGQDLAGIITILANNCDDLRKANGLV 48 9 19%
4934 LTG-28-LTG LTGAIEVTLLSLLPDQEYAPGDLDGDGLYEDLTG 49 12 24%
4935 GAG-27-IAG GAGTSGRLGVLDASECPPTFGVPPGLVIGLIAG 53 34 64%
4936 IGG-25-LVD IGGGSSYTPELLEGFIKRYDELPVRELWLVD 34 19 56%
4937 LAT-29-VGL LATGSSPETFYAEDVFSDLDFSDLTSLNLDEYVGL 45 10 22%
4938 TLI-27-GLV TLIEESELLEAQAAEATAEELKGALPEFEVGLV 40 13 33%
4939 LVL-25-IGL LVLFILALQLKGFTAGARGLLLGVLVVTIGL 60 6 10%
4940 LEA-29-ILA LEALLGLRLFERETRRLILTIAGKAELALAERILA 44 9 20%
4941 LEA-29-GIV LEAVAKAGVPLLIIAEDVEGEALATLVVNVMRGIV 37 13 35%
4942 LVV-26-LVI LVVVGGGSLPLALLLAELALLAVRNGWEGLVI 40 6 15%
4943 DAL-26-LGV DALTRSGNDPTVLIGAGVGLPAVTATLVGLGV 51 6 12%
4944 EIA-27-VLL EIALRILRACKELGIKTVAVHSTADRDLKHVLL 40 18 45%
4945 EAI-28-LSL EAIANALAAEDLPLARAQLIFRGIGLDVLLILSL 46 8 17%
4946 LLP-28-LGV LLPNVLLLIIVALTLNIVLAILSEASLSPLGLGV 62 15 24%
4947 DLA-26-LFG DLALSYAKGIGGLRAGSIETTFREEIETDLFG 35 11 31%
4948 LVD-27-LVL LVDLAGIRDTDDLAEQIGVERAKAALVEADLVL 44 8 18%
4949 GEL-24-LDG GELVPDEVTVGIVKERLSEPDAKKGFILDG 42 16 38%
4950 DLV-25-AIL DLVIEADPEAAIFAITFDPFIVYTSNIFAIL 36 8 22%
4951 TLG-25-GFL TLGVALPWAIAAALVRPQGKVVSVSGDGGFL 33 16 48%
4952 SGI-28-LLV SGIGGEELGYGATLVIAGVLGIMANIEVIAILLV 44 6 14%
4953 TIA-26-IAG TIAKEIELEDPFENMGAKLVSEVASKTNDIAG 36 22 61%
4954 SLG-29-LGI SLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGI 52 30 58%
4955 LLN-29-GVV LLNLKNVVPAMEIMLDDFGFGLSKRRVTLSTSGVV 34 18 53%
4956 GVI-28-GGS GVIGIIYESRPNVTADAAALCLKAGNAVILRGGS 33 18 55%
4957 GVG-26-LIE GVGEKTLALEPFHPDRIASRILGMGDVLSLIE 34 15 44%
4958 GGI-25-IGV GGIGGILARHVEGASHMAEGYTRATAGNIGV 39 9 23%
4959 ADL-24-LLE ADLVLDLLVREALRAGQRIELTPKEFTLLE 57 16 28%
4960 IDL-27-EIL IDLDEPFPEDAERQPIHKKAPSFDELSTSVEIL 37 17 46%
4961 DIL-27-LLA DILPALLIVQAGHLIAAPMDKLAGAELQRALLA 47 7 15%
4962 VSV-29-LLG VSVTGSVAAGAVPLAVLLALDVRLAVAAEAVTLLG 49 10 20%
4963 LGY-28-IAS LGYDSIVRHGAGSGQPVDVTMGYRYREEKGFIAS 32 7 22%
4964 VLA-29-IGA VLAKYMRVLTPAFVARFPNKIINIHHSFLPAFIGA 57 19 33%
4965 LTL-27-LSL LTLLLLTIVLSKILAIPVALLVGLLIGGVLLSL 66 6 9%
4966 AGL-29-IAG AGLAGLILALLALAERAAEIAAAALLALGLAAIAG 66 1 2%
4967 LLV-26-LTG LLVTSADRPDVLVAACLAAMNGVEIGALLLTG 56 13 23%
4968 LGI-27-GIL LGISARAWSALRLILAHLPVGGTYLNIMVNGIL 51 6 12%
4969 GLA-26-LAS GLALALSSLETVAALVLPAALPGLATGVVLAS 67 8 12%
4970 GIA-28-ELL GIARALADKPLILLLDEADGALDPATRAGIIELL 51 25 49%
4971 GAG-28-LGV GAGEGWAKSILFNARLRDQFAAFFARPDTFALGV 62 24 39%
4972 GSG-29-TLA GSGKSTAARLLEDAYDYDVGNILVDGLDLLAYTLA 46 14 30%
4973 GSL-28-ALS GSLGAAAKLLIILAAAGRGGFSLGRDLLAGMALS 49 6 12%
4974 AKL-28-LAT AKLTKRMRVIREKVDATKQYDINEAIALLKELAT 40 11 28%
4975 IEA-28-IAL IEANEAFAAQALAVGKDLEFDEEKVNVNGGAIAL 40 19 48%
4976 IGV-24-LGG IGVNTAAGFVAEVGDIEKYEHGKQIQKLGG 44 9 20%
4977 RIL-26-LLF RILIKLASTWEGIRAAEQLEKEGINCNLTLLF 31 22 71%
4978 LDV-26-LGT LDVRTGVLPRTHGSALFTRGETQALVTVTLGT 32 12 38%
4979 GFL-28-ALL GFLALGILGDGAALALLAHLVAGAGLLGLETALL 58 9 16%
4980 LNA-24-LIG LNAAIVGQPAGKIAELAGAEVPEDTKILIG 36 11 31%
4981 VFL-28-LVA VFLTGSDTSSNAGFSFLQFATAAQIAVSDSLLVA 39 14 36%
4982 LLG-29-GDL LLGILAHSALSLGLVVVSLLSNVRVDLMAYLFGDL 47 15 32%
4983 LTL-29-IVL LTLLTSLFYMHLLFSLENVDKVVLSIVAWFVYIVL 46 7 15%
4984 LLT-24-GEL LLTKILDANDWLSVQVHPDDAYGLKHEGEL 45 13 29%
4985 ALK-29-GLL ALKTADSGILLRGLVDVAADVLVRAIDCGTDRGLL 49 22 45%
4986 VAI-25-VVL VAIADVLAEGLAMVVLFDGPARWGMALSVVL 41 7 17%
4987 LGT-29-TLL LGTMQGGYNIHPLIDLLDDAKLAPIAAKALSHTLL 39 20 51%
4988 VGK-29-LAL VGKIVNTEGLAGKIRVLSVPDALEERFKKGLDLAL 39 15 38%
4989 EVL-28-LGY EVLDMTVEEALEFFENIPKIARKLQTLVDVGLGY 30 18 60%
4990 AIS-29-GIV AISDPIMGLLADRTRIRAGKEEPDGRIGALAIGIV 34 10 29%
4991 IAT-25-VEL IATRQSPLALWQAHYVKDKLMAIHPGLVVEL 33 11 33%
4992 IVD-26-IGG IVDNTFATPYLQRPLEHGADIVVHSATKFIGG 33 20 61%
4993 EAL-25-LAK EALALVSSAAMAGIVLNDAVNQAKEAFDLAK 58 7 12%
4994 LLV-28-VIA LLVVGPALITALLAEAAFLLESLVQGIAAATVIA 54 13 24%
4995 AGL-28-SGL AGLGQNVARQAAVKAGIPVDVPAFTINGVCGSGL 61 19 31%
4996 AVL-27-LLI AVLLALVLLALGFASLLLSLVPKGVAGALLLLI 64 6 9%
4997 LGG-28-VAL LGGLIGVLCVVLFNPANGTCFASFGAHPDFGVAL 63 12 19%
4998 RLL-26-DLI RLLTKALRPLPDKFHGLLDQEQRYRQRYLDLI 39 19 49%
5000 ELI-25-LIE ELIAANHEVDEIRDIIGADSLFYLSLDGLIE 40 15 38%
5001 VDL-26-GLI VDLAIAAGEGLAVLGPNGSGKSTAAEHIVGLI 38 8 21%
5002 IVS-28-AAL IVSGAGAAILVGGAIPPLLALLGLATALDWLAAL 51 12 24%
5003 ITA-28-EGL ITAEIEVGRVYFGKVTRIVDFGAFVAIGGGKEGL 31 11 35%
5004 VLS-26-LLI VLSVVVGVHYSRLGAVLLGLVVLLAGSLILLI 52 6 12%
5005 GLI-27-LLI GLIVGLIAGGLIGGAARLLIILSELIGGILLLI 54 2 4%
5006 LDL-29-DLA LDLLLKRRLTLPGLAIARPGEFSEVAFLNDKLDLA 49 9 18%
5008 VVL-28-VGI VVLSIKALEVDLNRISPALKSLSGDVRAGEIVGI 39 7 18%
5009 AFL-29-VIA AFLIVELNSKAPLKVFKFLPSSSTAEVLLVYLVIA 41 18 44%
5010 AEI-27-LAL AEIAGHAAAVEVAHVTLLGIEGLAAAAAGALAL 51 7 14%
5011 DAI-29-GAL DAIVVVENVERVMSEEGLPPREATRKSMGQIQGAL 42 31 74%
5012 IGS-27-ALI IGSFLFLGPTGVGKTELAKALAEVLFDDEDALI 39 17 44%
5013 IGS-27-NLA IGSNAPFVGLFGTVWGIMNSFIGIAGGQTTNLA 29 10 34%
5014 ADL-28-VIV ADLSPVVGSEQGGVRPVLVIQNDIGNRYSPTVIV 37 14 38%
5015 NVL-29-LGA NVLLQVLDDGVLTDSEGRKVDFSNTIIIMTSNLGA 36 12 33%
5016 GLL-28-IAV GLLAGGNRAELEGVIGRECSLLRAYLIRLLAIAV 55 14 25%
5018 IGL-27-ASL IGLGLAELGLLLCLKAVLPIDAAGGAQPAFASL 50 14 28%
5019 GLA-29-VIG GLALLLAALALGLIRPRPLLAALAGVLLGVAVVIG 54 1 2%
5020 LAT-28-IAV LATDAVLLTGGLAALTAFGAHAIMEALTGQGIAV 41 6 15%
5021 VVS-25-GAL VVSMLNSYSGWAAAAAGFMLSNDLLIVTGAL 44 23 52%
5022 VLL-28-GIS VLLCLGDFLFIPVGSVGALFYLLGGTLALPAGIS 43 5 12%
5023 LVL-24-YLL LVLLAGLALGAFAIQGLEGIIDSDLEFYLL 47 6 13%
5024 LLV-25-IGA LLVGGVGIANIMLASVGERTREIGIFKAIGA 52 17 33%
5025 ALI-25-GLG ALITRGLAEVSRLGAALGALLATFMGVAGLG 71 21 30%
5026 LGV-25-LVF LGVDPVKADQQVSGAVVLPNGTGKTVLVLVF 40 13 33%
5027 GLG-29-ALK GLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALK 42 12 29%
5028 LGA-24-GVL LGALFAALDLLVLLGGAAGLLIGALGRGVL 70 1 1%
5029 DVL-27-VIV DVLLLDEPTNGLDIQSISWLEDFLINFENTVIV 35 20 57%
5030 IGA-28-GVS IGAKVGARGGGMYGFYDKLQEVSLPRVRDFTGVS 38 22 58%
5031 GKL-25-ILD GKLEARGLATTIKAAKGMVEREELVVWDILD 33 10 30%
5032 VEL-28-ELA VELVPLLREKLAANLKARLAALPATETQVGEELA 45 6 13%
5033 LGT-27-LSL LGTDDVGRDVLSRLMYGARLSLLVGRLVVVLSL 43 12 28%
5034 ALS-24-LSL ALSPSKVLAVAVDESAGATAVGVPDVALSL 68 12 18%
5035 AAL-26-LSV AALDAAAVALGLERLPAPVAAALGGLAAALSV 68 6 9%
5036 VLV-27-ALS VLVESERLVLVDSLNDVLALLESLSLVDVDALS 57 15 26%
5037 GLA-29-GSL GLAGLAAALFLIRDGLMCGIRIHGLEALPLSGGSL 55 18 33%
5038 LVA-28-VLV LVAGFGLSIVDAALALAFAALLAALVLTGALVLV 65 7 11%
5039 EVL-27-LLA EVLLSDLRGAAFEFVERGSDDVLLPWENEALLA 67 7 10%
5040 LLG-27-GGI LLGCLVTTGIGAVLNTAKVKEGATVAIFGLGGI 52 17 33%
5041 ALS-25-GEL ALSKLAEEDPTFRTKTDEETGQTIIAGMGEL 50 18 36%
5042 IGL-28-ALE IGLYNSKAENIIKTCRILLEKHNGEVPEDRAALE 43 20 47%
5043 IAG-26-ILA IAGVDIPDDKRVVISLTYVYGIGKTTSKAILA 52 23 44%
5044 AIG-29-LAT AIGARTTLSQTHREMASGLSMPVGFKNGTDASLAT 46 9 20%
5045 GIV-29-LLP GIVNLLGGDRSGGISQALRVIALISRALGILLLLP 39 11 28%
5046 LIA-29-SLA LIAGALLAGGNILSLALLIGALQAVNFAEGAVSLA 56 7 13%
5047 LLI-24-LVG LLIAFSFGALLVFIAGLGAPVAIAGALLVG 54 7 13%
5048 LTL-26-SGL LTLASSSLSDLHAPLVEHILAGVVGRIYTSGL 48 9 19%
5049 IGL-27-VVL IGLSLSAVSGSFKELEGRGVVALLLRGTLEVVL 52 7 13%
5050 GSG-26-ALT GSGKTEVYLQAIAEALAQGKQALILVPEIALT 42 24 57%
5051 LVD-25-GID LVDELAHTNAPGSRHRKRWQDVEELLAAGID 34 16 47%
5052 GEL-29-AIV GELLVDGPLPVDQPVEEGCGKCLACMTICPTGAIV 37 12 32%
5053 LAT-26-GLD LATKISFINEIANICDKVGADVTKVAVGVGLD 42 17 40%
5054 GVG-25-GLS GVGGREVGFLAGFMKFLSNNTACVFTGLGLS 40 11 28%
5055 IVV-24-LGI IVVAPSQTLSDGEYQMLRLLSLKIIRALGI 41 13 32%
5056 ELL-25-DVL ELLQRLMAKLGAEQGVAALVKATQDKVGDVL 53 6 11%
5057 LAK-28-VLG LAKSLNKYLEVNHTSIDVSDGFKDVGLLFSKVLG 43 8 19%
5058 IGL-27-IAD IGLSIDQVFSHIKWLEWIKELLGVEIPFPAIAD 34 12 35%
5059 LVA-28-VLE LVADLIRGKKVAQALEILTFSNKKAAVLVKKVLE 49 17 35%
5060 LVS-25-ILG LVSAILGELFRQAIRFTLNVVKAAIGELILG 42 6 14%
5061 GGG-27-TIA GGGFTEQMQQKKTNAPIKNEADNGLSNTRGTIA 37 24 65%
5062 LSV-27-GAG LSVSYGDGQAVRDISLDLGAGEIIGLIGPNGAG 49 21 43%
5063 ELV-24-ELL ELVLRRELLQRILEGAGYPIASGTRLEELL 48 6 13%
5064 ALT-26-KLA ALTPKAEAEGEIGDIDMGLAARMMSQAMGKLA 41 9 22%
5065 GVV-27-IEA GVVLQENNLFLESIMDNIALTGPAASIECIIEA 34 12 35%
5066 IGV-25-VIG IGVLGWGVGGIEAEAIMLGQPSYFPIPEVIG 40 13 33%
5067 VIV-29-SLA VIVTDGHHFGATLAKLLAIINLVLAVDLGASCSLA 37 13 35%
5068 LEV-24-ILV LEVERIINEPTAAALAYGLDKTDKDQKILV 30 24 80%
5069 VLG-27-LGV VLGYLLAGLAIGPFGLGLIADVLAILHLRELGV 61 17 28%
5070 VLL-25-DLI VLLILLDGLLATGRSANCGKAEVIGIIGDLI 39 12 31%
5071 ILA-29-VIV ILADEPTGNLDLGTAGEIISHLKVLALLGAKCVIV 44 10 23%
5072 ALV-28-GID ALVADFGGLTRDRKYGRARFEGPEFGCIDTDGID 38 12 32%
5073 VLS-26-ATL VLSYALERASPILALVLVSVQAEALDASLATL 43 12 28%
5074 EVL-29-VLF EVLDVMKSLAKEGMTMVVVTHEMGFAREVADRVLF 34 17 50%
5075 KLA-28-ALA KLASLGEKKLAAQLCKLARRLGKRLAADIAQALA 64 10 16%
5076 ELI-26-SVV ELILCRLHAGGKFSNKNYQFSGGLHGVGISVV 31 19 61%
5077 PLL-26-LAS PLLSGPMLALGFTAGEGPLIALLARFIGLLAS 53 8 15%
5078 GAI-24-ALI GAIFAAILALLAGFFSAFYLLPFAILIALI 54 6 11%
5079 ASG-29-YGL ASGGFFAPFVEPDLQWDFRLANVISINTSGHKYGL 29 15 52%
5080 GVS-24-AIA GVSLSTVSGVLIGGGGVSGGGRVTLLAAIA 46 1 2%
5081 GFL-25-SVV GFLGLLHMEIIQERLEREFNLDLIMTAPSVV 30 17 57%
5082 LAS-27-GIS LASNATRGGIVAALAACGGLLEGIGVQGSNGIS 40 9 23%
5083 SLA-26-ATL SLAAGAAAAVARPLGAAVFLGFGDALARIATL 54 7 13%
5084 GVL-26-KLA GVLRLMLETDGEQVDRIDPHIGVLHRGTEKLA 45 10 22%
5085 RLL-24-DAI RLLEGYDRKTLKRDLQGMFDLNSRYVDDAI 38 14 37%
5086 FLL-24-VAL FLLSLGHLYAHLALGELKLWASLGPLIVAL 52 4 8%
5087 LVL-24-TLL LVLDLITFLLLAGAVVALLGASGSGKSTLL 71 15 21%
5088 LDL-25-GGI LDLTRQEATRAFFEGALPDLVFLAAAKVGGI 35 12 34%
5089 LVA-29-SLL LVAAYLVALYAILFLILLLRTGLVVTAFAPGASLL 69 7 10%
5091 LLF-27-AAL LLFGLAGVVGAGLFVVLLIQLEGLSRVALGAAL 63 7 11%
5092 NLL-29-LFG NLLADALLASALGTFGHQGLVYSDGGINFPLGLFG 35 12 34%
5093 GGI-25-FLA GGINGAVNTKGEGDSPWIHFDDTVYGGDFLA 35 11 31%
5094 LFG-26-LDA LFGLGTGMAEDGQSLVGATVVRRRVYARFLDA 38 11 29%
5095 IVV-28-LAT IVVLEALASNFALVLADIPVGALGAAEAAAALAT 39 5 13%
5096 EAL-25-LLR EALARIELELRVGPRIGLVGHNGLGKTALLR 60 9 15%
5097 ALE-25-LGF ALEEALHLLGVSTYLLDGDNVRHGLCSDLGF 37 17 46%
5098 ALV-29-AIL ALVGLGALFGALIAALAILLDATENVIGFLAAAIL 60 6 10%
5099 VAL-26-ILA VALALALLAGILLLLLLLVGFALALAALAILA 57 2 4%
5100 IVL-29-ASG IVLNMMNQDGVRNGYDLAQLKKVRKVCHVPLIASG 36 20 56%
5101 ITL-26-GIT ITLAPVATVLGLAFKLSDPDGLLGDKEDLGIT 34 22 65%
5102 LNA-27-GGG LNAIVGLARPGDMGFDVVHLNLHKTFCIPHGGG 35 27 77%
5103 VLA-28-IVL VLATQTLKQKKAKTMKIEVEGKLPPGVTAKDIVL 55 22 40%
5104 LGA-25-SGL LGARLLDANGNVAADGGGGLAALNMGDISGL 52 9 17%
5105 GVL-25-ILL GVLPQGTAFNAMSLLNLRSLSGSAALGGILL 56 5 9%
5106 GVL-29-ASG GVLTDGYMALRTAGEGLLLAIIADGAALARLDASG 51 11 22%
5107 AAI-26-SGG AAINPGNSGGPLVDADGPVIGINTAIISLSGG 44 20 45%
5108 LTI-25-ALI LTILSTLPSAGVGALLALELFGAPFSLIALI 38 12 32%
5109 IPL-25-LLG IPLKALKPAEVYALIVKTFRLGIGEIGGLLG 47 5 11%
5110 LVL-25-ASL LVLLPLSVPIAAVVAILSFIAAITEVPVASL 59 10 17%
5111 TLL-26-ASG TLLNSDGAISEETKVALDAAQEKGVAVVLASG 47 12 26%
5112 LSG-25-VLG LSGTMAISETTVVLPALLAADEINAIGGVLG 55 12 22%
5113 VLG-25-SAL VLGQALLAKRMLQIAIAASRGAGAHGAASAL 54 7 13%
5114 VSL-24-LTG VSLLVETGEILALLGPNGAGKATLLAALTG 43 24 56%
5115 RLL-28-DLA RLLHDTKQIYEDQLAALHNDSKRVGTQGEKLDLA 54 15 28%
5116 LTG-25-VLG LTGTEAALGAGLADVLGQVVSGEHLVQEVLG 53 7 13%
5117 GVI-25-LVL GVILAVLLSILLGLDNIEVVGVTDALESLVL 51 4 8%
5118 GVV-29-SGI GVVTVEEEPLQINWRLQMRLDAFLIAEVIPGISGI 34 15 44%
5119 GAS-28-IAG GASAYSRTIDFKKFREIADEVGAYLMVDMAHIAG 43 30 70%
5120 DIV-28-NLA DIVGLEAGSQSFRIAKSILNKGVQVIVLNPGNLA 30 15 50%
5121 NVL-26-VLV NVLLAEAKVPYDIVLEMDEINDDFADTDVVLV 34 25 74%
5122 LLV-25-GAS LLVERLSDARRNGHRVLAVVRGSAVNQDGAS 49 28 57%
5123 IAL-27-ASG IALAAALAASLLAALALDIGLEALHRLAAAASG 49 4 8%
5124 LGV-28-FLG LGVSYGLSADFTLCLVAGLGGAFTAALGLLLFLG 43 11 26%
5125 IGL-27-AIL IGLPLTAVRLISYFLSKAIGRGIIIGLIVVAIL 50 7 14%
5126 LDL-29-GAI LDLIEANEAFAAQALAVAKDLGLDPEKVNVNGGAI 37 21 57%
5127 VGL-26-IVL VGLLMLSNVAKLDFADFVDAMAGLVCAVFIVL 43 13 30%
5128 IAG-27-ELA IAGYLLKVEESLTLSEKKPTPLPLDVVIADELA 47 15 32%
5129 DAL-25-ALN DALPLLSDAWQLSGLNAEIGLALAELAAALN 37 6 16%
5130 IGA-29-LVL IGASDDLASGRSTFMVEMTETANILHNATIASLVL 56 19 34%
5131 LGS-24-LAS LGSLVLGWIVDGIGRLKILTFLFLLITLAS 42 5 12%
5132 LLE-27-ILV LLERRLDNVVYRLGFATTRRQARQLVNHGHILV 41 18 44%
5133 LGV-26-DVL LGVNLRQTSGPVIEKAGDLAALLTNLEPGDVL 42 21 50%
5134 AGL-29-GGI AGLSLALRLAVLHKVIVLSKGPLLEGSSFWAQGGI 55 17 31%
5135 LDL-28-NLA LDLISQIELLVLLLALSKEANIAAIKVLHDLNLA 34 15 44%
5136 LVG-25-LGF LVGGVLLAPLLAVDGKFPVVHLVRVIMHLGF 39 7 18%
5137 LVA-26-VID LVAGFALLANDMAELGDWDEMPYLGADGAVID 37 10 27%
5138 VVL-24-GIA VVLGIFVVSSGIAASFLDAAGCAALMVGIA 49 12 24%
5139 VVL-27-FGL VVLGSLLAQLLVEGKLAFALGLVGLSFLSGFGL 41 8 20%
5140 RLL-25-GEL RLLAEAQGDVSLRVLATSSADKWEVSGRGEL 50 14 28%
5141 GIL-28-VLL GILAAFGASGLLGRSLRFLLLAGALEPVTIGVLL 52 6 12%
5142 AIG-27-VAI AIGLKLHADWGSGIAAIITKLGVAAIAGVQVAI 41 14 34%
5143 IAS-25-ALA IASKVAIAGPGFINIFAAPKFLLIALTAALA 65 8 12%
5144 SGV-28-GGG SGVDYGHLLDVCRAMRTCVKPVVADVAAISIGGG 42 21 50%
5145 GIE-26-ISA GIEVYELGVIATPGVAYLVRTEKADAGVMISA 29 14 48%
5146 GLL-24-GLF GLLVGNAELAAIGPPLVALDAGKLGPLGLF 51 6 12%
5147 ALS-28-LAT ALSLLIALGLAGATAGSLAESFDYLGSGLLTLAT 57 7 12%
5148 LAK-26-VVL LAKALGKLSEGVERSALKEVLAILLAGKTVVL 45 12 27%
5149 VLG-24-IGV VLGWGVGGIEAEAAMLGQPSYFPIPEVIGV 49 15 31%
5150 GIL-25-AAI GILYLENNLTIGAFTSDRIEVLVLLEAQAAI 49 13 27%
5151 VLD-27-LGY VLDMTVEEALEFFEAIPKIRRKLQTLVDVGLGY 28 27 96%
5152 IGV-26-DIV IGVHQDGLVHISALSDKFVKDPRDVVKAGDIV 39 27 69%
5153 GLL-25-IAG GLLAPEFAEGLLGGAEVRETFLGSKVGLIAG 59 14 24%
5154 AIA-24-VLG AIAADPELAYDLTVKKNTVAVISDGVAVLG 62 17 27%
5155 VLA-27-LGI VLAALGGDALDALGVLGDTIASTAPATLELLGI 64 3 5%
5156 AVL-24-TLL AVLKGVLLALAAALFTLILGPSGAGKSTLL 71 10 14%
5157 LVE-27-EAL LVEDNLANRRLVSGLLAELGAGVLEAGSGIEAL 64 11 17%
5158 LSG-25-AFL LSGFTAKLAGTERGITEPTPTFSACFGAAFL 44 14 32%
5159 ILA-29-IGL ILAGVAASRLIVILGATIASTLLALTLGAPIIIGL 57 6 11%
5160 LLK-27-LSA LLKSAQIAAAALGAGLALEVALATTDNLASLSA 50 5 10%
5161 GLG-24-LGT GLGFLWFNTLPAQVFMGDVGALALGAALGT 45 13 29%
5162 AGL-25-TIA AGLEVKRIINEPTAAALAYGLDKGLGNRTIA 43 14 33%
5163 SLA-25-VIE SLALGGLIAAVSILLHQELLLILIGGLFVIE 35 16 46%
5164 LGG-29-GVS LGGYQSINELILPGGRLLEQRNRAWELINDIPGVS 44 22 50%
5165 GLA-28-LLF GLALSSTAMALQLLAERGLLRSAHGQLGFAVLLF 53 16 30%
5166 LVA-25-LPL LVAGAFALLVLFLHIALAGSSKVLLACSLPL 58 9 16%
5167 GLV-29-ALK GLVDILGVSAAEALLGPQQQVLDLFANEATAAALK 41 13 32%
5168 DLA-26-LAS DLAGFAVGVAEKRQIIDGSKIAEGDVLLGLAS 51 18 35%
5169 GAI-26-FLL GAIVARTIMILLGEWLIQAFPWLLYLAGAFLL 37 9 24%
5170 DLV-25-ADL DLVTKGTNEPYRLLTSRAEYRLLLRHDNADL 43 17 40%
5171 AIS-27-GVV AISLVVVFLKLAALYESWAIPFSVLRVVPLGVV 33 6 18%
5172 ALN-25-ALN ALNQATQRMDLVASALRTATSQRLGAQQALN 35 13 37%
5173 IAD-26-VAI IADTDLAGPEPKFFAFPACVIVKHANGSGVAI 30 13 43%
5174 VSV-25-LTG VSVVNLPNDEMKGRIIGREGRNIRTLETLTG 37 17 46%
5175 VLL-29-ILV VLLYYKYTTIDDPELFAKEHLAFCKELGLKGRILV 50 14 28%
5176 LGV-29-GGS LGVIGIIYESRPNVTADAAALCLKAGNAVILRGGS 41 21 51%
5177 LAK-25-KLA LAKKLIDASFAERVFFANSGAEANEAALKLA 48 13 27%
5178 ILG-27-LPL ILGAAQDGAIPAEASLSLLGLGVQMLFKLLLPL 45 15 33%
5179 GSG-25-LGG GSGPAGLSAAGRLALLGLKVVVIEALDRLGG 53 21 40%
5180 GVG-28-SLG GVGSTAVAAGTALGAAVAAVLGRESTTDYAHSLG 39 9 23%
5181 TLI-27-LGG TLIGVLIGPLAFGALAFAAGAVEGFLQGLILGG 40 8 20%
5182 AFL-25-LGV AFLPRHGRGHRIPPHKINYRANIWALKALGV 43 13 30%
5183 GLS-25-VFL GLSSTLALALAHTGVAFAFFSPFLGWLGVFL 32 9 28%
5184 ITA-28-FLL ITAGMAIYDTMQFIKPDVSTICMGMAASMGAFLL 31 17 55%
5185 GSI-26-LAI GSILTNKYAEGYPGKRYYGGCDFVDVVETLAI 41 18 44%
5186 ALL-26-LNA ALLNGLVPLGLLHGATLLDARLENAVVVALNA 55 4 7%
5187 ALA-25-AIT ALAVEGAGIALARALALVEAGAVELAPAAIT 57 7 12%
5188 LIA-24-LSA LIAGAGIALGNEAIELGAGLQALTTTALSA 58 3 5%
5189 ALI-26-IAL ALITDGRFSGATRGISVGHVSPEAAVGGPIAL 59 17 29%
5190 LLI-26-GIA LLILDAGDAVLTELPRLTLLLFILLLQGIGIA 48 4 8%
5191 LSG-25-GSL LSGGEQQRVAIARALAKPPAIILADEPTGSL 49 25 51%
5192 LIG-26-LIG LIGIAGTIGLTPVSAVLEVSLIAAGLAGGLIG 55 2 4%
5194 VSL-24-ASG VSLMLMALGGLFANDLVEWVSVATYQAASG 41 20 49%
5195 VIG-26-LLV VIGAVLAVGSSFIIAEAGPAVLVARLLAGLLV 52 11 21%
5196 SLV-24-IGL SLVNSTSGHVLVFGLDLLRSLVAALQLIGL 43 12 28%
5197 LLP-29-VVL LLPWSAYLAGQSPFVTFFSKLGVPAAGLIMNIVVL 49 16 33%
5198 ITL-28-VIE ITLYLKHNTKEPNTIKSVHFTSLKRGPMGDAVIE 29 10 34%
5199 NAL-28-ILL NALRRERGPVSIYLVNGIKLQGQIESFDQFVILL 35 13 37%
5200 LTL-24-VGI LTLMETSKGIAGVGGVSFVVLLATLLVVGI 38 9 24%
5201 LSA-27-AKL LSAKPLEVQPRTGIILLAPALMQLVPGELQAKL 44 7 16%
5202 LAI-26-LGV LAIFLFLGGWRTQASSLVVLLSPALLTISLGV 58 13 22%
5203 LAI-29-DLA LAIAAALAAIRDLARFVALAAAAAGSGLSLATDLA 47 6 13%
5204 IGL-25-VGL IGLGLSPVHLALPALFAINAWAAADGILVGL 50 7 14%
5205 GLI-25-ISG GLIALMLSLDQIGPLIILADANARLLKPISG 41 12 29%
5206 GVL-29-IEL GVLKAVENVNGIIAPALLGMDATDQAAIDQIMIEL 37 23 62%
5207 VLE-28-GLG VLENQLSISEGASRLSLPEGTLGQWVTAARKGLG 44 11 25%
5208 VGL-27-LLV VGLVAPHIARMLVGVNTRLLLPLSALAGGLLLV 65 22 34%
5209 VIG-25-GAL VIGPELGLTLPGMTVVCGDSHTSTHGALGAL 54 12 22%
5210 KLA-27-GEL KLALAQLPTFLWLGCHDPRVPAERLTGLEQGEL 39 8 21%
5211 LLP-28-GAS LLPQTVARLKIAIIKADASAGAAPVLGALALGAS 40 9 23%
5212 ILD-25-ILG ILDQFQFHQPLVACTLIGLVTGHLEAGIILG 34 14 41%
5213 VSG-26-GLD VSGLARGIDTTAHALALFNGGQTEAVIGTGLD 35 13 37%
5214 IGV-29-LLI IGVALHGLAAAAAARLYTLLAIGDGLLSQAPSLLI 41 9 22%
5215 EIV-29-AVL EIVPAFKGISEKLVPNSKPALDCPIVFPYAPNAVL 41 15 37%
5216 IGS-24-AGI IGSNQGLETKAMLEIIIEQATVPVVVDAGI 36 20 56%
5217 YLL-24-AIA YLLKDAGLSDKLPLLGSLLSGGQIQRVAIA 39 13 33%
5218 LIA-29-LTL LIAIVAALGGLLVPALGVVFLSLLAAALWYNLLTL 58 10 17%
5219 AGL-28-LGI AGLTLYGRMFDGVAVLLSLERTSLASAAMAALGI 65 10 15%
5220 VAL-29-IAG VALNNGTLAHPVGGVHTLSGPSGQGASTGLGIIAG 56 17 30%
5221 GEL-29-LDI GELSGGERPRQHLAKVLSVAGKLLLLDEPTNDLDI 34 10 29%
5222 SGI-27-LNA SGIDAGSKVISHVAAGEVSETSTDAVNGSQLNA 31 11 35%
5223 IAD-25-IAG IADRPGLAPGLIGGMLAASTGAGFIGGIIAG 35 21 60%
5224 LDI-27-GSL LDIMIGEGPAARSIKIDLPPFTLIGATTRAGSL 32 17 53%
5225 TIA-27-LID TIAMAKLVGAGQHTLFDLLFRHRDKHKGLLLID 32 11 34%
5226 LLI-27-LGF LLIGFGFNAFLEGAAGFGVPIAICAALLIGLGF 44 16 36%
5227 IGL-27-LSL IGLGLLAYHLLLKALYAILADVALDFILLGLSL 58 8 14%
5228 GLA-26-AIV GLAGALSATLTLLPLGDGGGLGVLAGASLAIV 58 6 10%
5229 LVE-28-GLL LVEPAAVALAAARKAALLQGDAVAVAGTGPIGLL 46 9 20%
5230 SLG-26-GLG SLGVVRVVGEKSFVVADILGLIEGAAEGAGLG 49 12 24%
5231 DAL-27-LEA DALEALADGLDALAADEAEKLLALTAAEAALEA 54 12 22%
5232 LTG-29-EVL LTGPVTILVWSFERADISRKKVTKQIALAILDEVL 41 17 41%
5233 TLA-26-ILA TLALLVLALLKLWQFGALEFWLILAPVILILA 51 12 24%
5234 VIL-29-AVL VILVDDVLYTGRTIRAAIDALVDLGRPARIQLAVL 49 18 37%
5235 IVA-24-IAG IVAASVGISSLAGLSKAITEVQGNGLGIAG 43 16 37%
5236 GIV-29-VLL GIVKALKVAEFIVSLQSAIGAPGAIDKDELLVVLL 47 14 30%
5237 ASG-25-ALT ASGAFQVAKPSDLIPELQGRLPIRVELQALT 48 17 35%
5238 DVI-28-SGI DVIVANILADILILLTDDAYRLVKDEGYLIMSGI 29 14 48%
5240 GLS-26-ALN GLSSSASLEVAVGAVFQQLYHLPLDGAEIALN 37 11 30%
5241 GAG-27-VEL GAGETAAAGAGACAAVAVGDQQGLLLEPVRVEL 41 7 17%
5242 AIG-28-TLL AIGILLASGTLLILAILGNFDVLAVTIGGRMTLL 54 7 13%
5243 VLD-29-PLL VLDNPADLLFAEKEQALAEDLNVLRGVDDSGDPLL 38 14 37%
5244 ALT-26-GIS ALTNGHQQADTGTKMIHIGKNTKSTIISKGIS 36 19 53%
5245 IAV-26-VGL IAVGSLKGGAGKSTDAVNLALALAALGAKVGL 45 14 31%
5246 ADL-24-LIG ADLLAKGLRGLTLIGAEERGAKLRDSDLIG 41 8 20%
5247 ASG-24-LSA ASGFAAPAASAGVSAGTLRSAAAGAAALSA 51 3 6%
5248 ASG-27-GGS ASGKVLTGGVDANALHRPKRFFGAARNVEEGGS 45 24 53%
5249 LEV-25-GLV LEVANLEGRADVAVASFRDFPGEFLGGAGLV 39 9 23%
5250 LEV-24-IAV LEVKRIINEPTAAALAYGLDKGLGNRTIAV 30 16 53%
5251 VIE-28-LAI VIELKRDASAAVILNNLFKLTSLQTNFSFNMLAI 32 14 44%
5252 AGL-28-ITA AGLLLLVPAGDMFERRFGIVSLILLAAGGMLITA 44 6 14%
5253 AGI-25-TLG AGIQADIKTFQARGVFGMSAITAVTAQNTLG 40 16 40%
5254 TLA-24-VAI TLAMTAYADLDTSVIDELPPGRGPATTVAI 45 12 27%
5255 IGA-26-SGG IGAYVDEGTMVDTWATVGSCAQIGKNVHLSGG 41 23 56%
5256 IGG-25-LLV IGGRILLVAVARFLLASGVFEVFTAATLLLV 45 6 13%
5257 AEI-24-LGA AEIAGKKGGLLKGKGGSMHIADLDKGMLGA 38 9 24%
5258 IGS-29-LAE IGSLYKMNASISGAEVGCQGEVGVACSMAAAGLAE 39 9 23%
5259 ALL-28-VLN ALLVVDAAQGVEAQTLANCYTALEMDLEVVPVLN 49 25 51%
5260 LVL-27-ILV LVLFLGLLLLEVLSQLLSLIARLILGALLVILV 50 3 6%
5261 VIA-24-VIL VIADSGANPDFVASDLLSQAEHGLDSSVIL 43 11 26%
5262 AGI-28-LFG AGILLLLRFGPTGGAWAVTGEFTRWGGAILQLFG 41 7 17%
5263 LIE-28-LSL LIEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSL 47 12 26%
5264 LVV-27-AGI LVVHPGAGNPDGTVLNALLHHYPPIADVPRAGI 47 14 30%
5265 DLA-29-EVI DLAQACRARLSKPLGLLLWILAELAIIATDIAEVI 37 25 68%
5266 AKL-27-LDL AKLLLHCVELLENPIGTTALNYLTKGKTLVLDL 40 13 33%
5267 ILD-24-LLL ILDIPLDDLDFEKIVLLLRSANKGQLALLL 42 4 10%
5268 GLD-29-DLA GLDALRYYLLREVPFGSDGVFTPEAFVERVNFDLA 43 19 44%
5269 IEL-27-IAV IELFRIEVPEIGEEVIEIKAAARDPGSRAKIAV 32 19 59%
5270 ALN-25-IPL ALNIMDLHSPQSAILSAVIFNALIIPALIPL 28 19 68%
5271 SGV-26-LGL SGVLFSRLLRLALVLGANFGVALLGLAVGLGL 52 6 12%
5272 LDI-27-ALV LDIIKDRQYTAKADSVARRSCQTALYHIAEALV 35 13 37%
5273 VLN-28-VLS VLNFTLQFLEPLARQAELDKIILGLNPGGAKVLS 31 8 26%
5274 ALS-29-DVI ALSQGYYDAYYKKAQRPRTLIKRDFEAVFQNADVI 34 13 38%
5275 VLA-26-IAD VLAVGTEAKLMLGKTPGKIVAVRPMKDGVIAD 43 16 37%
5276 LLK-27-LGI LLKAIYAIALSMLLLAQALAVADKASLEGLLGI 47 5 11%
5277 IVL-25-LIV IVLGALLFGLSTALEQLFMAFAGALVASLIV 40 6 15%
5278 GIG-24-LSG GIGMARDDLIAHLGTIARSGTADFLASLSG 45 12 27%
5279 VLI-28-IGL VLILTAVLGPLVAELTIDPIIFGVMFILPFVIGL 46 6 13%
5280 LGF-29-DVL LGFENAALGPAALGFRGMPALLAKAEAETLLRDVL 31 15 48%
5281 AEI-24-LGG AEIVAQAGRPGAVTIATNMAGRGTDIVLGG 37 20 54%
5282 LVL-27-LGV LVLAGVCGGALLGLRVAPVGLVAAAAAGAALGV 66 5 8%
5283 AIA-25-ASL AIAAVALAIASALAGALLDRVLRFATLVASL 64 6 9%
5284 AVL-26-VVI AVLMVESEAELLSEDQMLGAVVFGHEQQQVVI 46 12 26%
5285 VSL-27-GGI VSLTFAVAVAMGTASFGVGGAFLEFAKVAIGGI 36 6 17%
5286 DVL-28-LTG DVLLAISTSGNSANIIKAIEAARERGMKVIALTG 42 24 57%
5287 EIL-26-FLG EILPNAISPVLAEFGLRFAYAILLLSGLSFLG 30 13 43%
5288 IGA-28-GLL IGAGPAGLACADVLTRNGVKAVVFDRHPEIGGLL 56 21 38%
5289 IAV-25-VAL IAVTGLAALVLELLLTVLNAPVAGAGFAVAL 55 6 11%
5290 SIA-28-SIA SIAFANAGQHQDTGAKMIHNAPHTSSSIVSKSIA 35 13 37%
5291 ILA-25-LLF ILAAFLVAGSLLLLRIAGLILLILLLLALLF 44 1 2%
5292 GLV-25-LVS GLVSGAVHTTANTIRPALQLIKTAPGSSLVS 44 18 41%
5293 LVE-29-LLG LVEAIVLVFLVMYLFLQNFRATLIPTIAVPVVLLG 56 15 27%
5294 IVG-26-SLL IVGGRLIALLSLELLQKLGLIILGAWGLGSLL 53 7 13%
5295 IAS-29-LTL IASRKASQNAIEAFGPLLPEFLGGSADLAPSNLTL 42 16 38%
5296 IAV-26-GAG IAVNTDAQALALVKAEPKALIGGKLTRGLGAG 44 11 25%
5297 TLI-29-LLF TLILDEADEMLNMGFLEDIEAIIGRVPARRQTLLF 37 16 43%
5299 ALT-25-VLA ALTAVLFLKAGSALLVVVLQLDSGLALPVLA 69 6 9%
5300 IEL-26-ILL IELFERGLKSKPYAQLLADIVARAGEKLLILL 35 13 37%
5301 FLG-29-GID FLGSGKTTLLRHLLDNAHGRKIAVIVNEFGEIGID 28 16 57%
5302 VGK-28-VGK VGKTEIARRLAKLANAPFIKVEATKFTEVGYVGK 29 21 72%
5303 LAL-25-IAS LALPIISLAWHEGAQGALAATLANAIALIAS 57 6 11%
5304 LLI-25-IVA LLIFVVDAANLGRLLYLTLILLELGAPLIVA 49 7 14%
5305 AIA-25-GVV AIAGAGPLVGPVLAAQMGYLPGTLWLLAGVV 53 23 43%
5306 LTL-28-VLA LTLVLALLELLEPHIALSRAVEAVIAPALGVVLA 69 11 16%
5307 GLI-28-IVL GLIVAPPKAGKTVLLQNIAHSITTNHPECELIVL 47 23 49%
5308 ILG-25-SLL ILGLDPYHGPGQAHGLAFSVVPGILLLPSLL 56 12 21%
5309 AGI-26-ADL AGIPEDDPRNPAVIADNVGDNVGDCAGMAADL 47 18 38%
5310 VGL-27-IGA VGLVPLAGQALRIVLSGAAFFIEALMLGAAIGA 49 11 22%
5311 DVL-25-LVF DVLTHAIEAYVSGMASDITDALAEKAIKLVF 28 15 54%
5312 FLA-26-IAS FLAIASSALAERGGKQLTPFLLSVIIILAIAS 32 5 16%
5313 IAD-28-VAL IADAFSINRGFKFRPDKMEKVLDGNDAYAAVVAL 39 9 23%
5314 IVD-24-SAL IVDSSALAEQVVIDVLASAFDSAGQRCSAL 35 20 57%
5315 LSL-26-NVL LSLKLKEFIEAAQVGGVSGDNIIIRHIVPNVL 37 12 32%
5316 LGI-25-LAS LGIGPLLVALVKLLAAGVNAAAVLSLLALAS 56 6 11%
5317 VAL-28-DLA VALSGRAAGNTALCTVGTSGNDLHRRGYDILDLA 53 10 19%
5318 VLV-25-IAA VLVDLGLDVLGASMMDETALAALLMAPSIAA 60 6 10%
5319 LGG-28-LLN LGGVSLKGGIGKIAGVVLGILILGTVENALNLLN 40 12 30%
5320 GLA-29-ELI GLAHALKPVVLLGSNGLTEGVLAEIERALAHHELI 42 12 29%
5321 LSV-26-LLP LSVLEGEKAPEKGAHILSGAVLMPLGKVDLLP 43 15 35%
5322 LIV-28-GAL LIVGAISDASIGQLVGKTGLSGTLRVLGIVFGAL 50 8 16%
5323 ELV-26-GIT ELVDMVEKLDLYITVKGGGISGQAGAIRHGIT 32 15 47%
5324 ELI-24-ILL ELIGITAGESEDPEKNIPKAINQVFWRILL 41 26 63%
5325 GLD-25-VAI GLDSLPHAILFYRQMLQWLGGMGIIVLAVAI 36 18 50%
5326 SGV-27-LGG SGVDVEAGYEVVERIKKHVARTERAGVMGALGG 43 13 30%
5327 AIT-25-LSV AITASLLSANPSYNRSALEGESRSVAQRLSV 32 7 22%
5328 VGK-29-LGA VGKTAIAEGLAKRIVDGDVPEKLADKVLYSLDLGA 34 19 56%
5329 ALS-26-LSG ALSLFGNSSLAGTLAGISANLLEFELGLALSG 60 7 12%
5330 AIL-26-LLV AILASAVAGLATALALTLRLERWVAILFLLLV 62 6 10%
5331 VSL-26-GLL VSLEVKPGEIVGLLGENGSGKSTILKLIAGLL 60 32 53%
5332 LVV-27-GAL LVVAGFILLALAEETVLMERNGIVVSALSLGAL 64 15 23%
5333 LGS-27-FGL LGSDTGGSIRQPAAFCGVVGMKPTYGRVSRFGL 34 18 53%
5334 AFL-28-GLD AFLATKISFINEIANICEKVGADVQKVAKGIGLD 33 20 61%
5335 ALG-28-AFL ALGLSLGALVFAEAVDNAPVTTLYLQFAIKAAFL 48 11 23%
5336 AVL-25-EVL AVLVPTLLLALQHFPNFRARFANLPERVEVL 50 10 20%
5337 SLA-26-LTG SLAITLATNNINVISQDLDPEIVKAAPSLLTG 50 20 40%
5338 SVL-26-ALV SVLGLVGGLVIGLLLGFARTFGGLLALGAALV 50 7 14%
5339 ILV-25-IVA ILVVAADDGVMPQTIEAINHAKAAGVPIIVA 43 21 49%
5340 AIE-29-AGI AIELFRSQWRDLFEVKRDPEHIYQQVSKGTLPAGI 37 10 27%
5341 LLS-26-SGL LLSAVPPGRAADLLIEKKATDYGLLAVILSGL 57 11 19%
5342 LLV-28-IAS LLVTSGDHLGAVALFDLLLAGAIAIAVVGLIIAS 46 11 24%
5343 LGA-26-ILL LGAYALSLLAFLGRGTINGIFLALTMLAGILL 57 6 11%
5344 GLV-26-GEL GLVIDAYFSGTKVKWILDHVEGARERAERGEL 39 22 56%
5345 LVS-24-GLS LVSTTVIEVGVNVPNATIMIIMDADRFGLS 46 25 54%
5346 LVV-29-AIE LVVDDQGKYYEFLNNKLGFEGVKQVLAKGGKEAIE 37 11 30%
5347 SGL-29-GLD SGLEVLRRLRYLGASTPIILLTARDQVPDRVAGLD 38 19 50%
5348 LLP-26-ASG LLPVDSEHSAIFQLLVGELESVLRRIGLTASG 42 12 29%
5349 LVI-29-IVA LVIMGLGGGAFFYPIVVILALASVGSAIEGLLIVA 38 8 21%
5350 IVG-27-GAL IVGAILNFVAGALERLTLLHGTDRALGVAFGAL 58 8 14%
5351 IAV-25-LTI IAVMLLKGFMTKLRSHKTYRDSEHTMSVLTI 33 11 33%
5352 LLD-27-DLL LLDAVPLDALTGVGAALAGKLAKIALETVQDLL 58 8 14%
5354 ALL-26-GIS ALLAGAALSQAIYLSGGIVAAPLLGLLLLGIS 50 8 16%
5355 SLA-28-GDL SLATLLRVLAAGAAKRGDYGALLIALEGRVQGDL 39 6 15%
5356 IGL-28-GIG IGLFNSGTGNVGFFNSGTGNIGIGNSGSFNTGIG 47 21 45%
5357 GGI-24-GGG GGIDTHIHFISPQQVGTALASGITTMIGGG 42 17 40%
5358 GKL-29-TLG GKLANKLRKEENARPLLIAADIYRPAAIDQLKTLG 32 15 47%
5359 ASG-28-LVG ASGLPLADLSGVYLAEGLVDLIRVKTITLISLVG 48 16 33%
5360 GEI-28-AAL GEISAASQEQSAGIEQVNQAVTQMDEVTQQNAAL 58 34 59%
5361 SAI-29-ALV SAIFLSRGDEVTSGSSVMVVWEGTRPLLVEIQALV 41 22 54%
5362 FGL-28-AIG FGLPAPVTLDVAILSTFGLLIGATTGGRLVDAIG 37 5 14%
5363 LTI-29-ALS LTIEEASDRYETQLEVTILQWLEAQRGQSELTALS 38 6 16%
5364 DVI-26-VIG DVIKSSGERVGPFEVESALVEHPAVAEAAVIG 31 23 74%
5365 LAL-25-FLL LALGAGLLILALLTALLGSLILLAILLGFLL 62 6 10%
5366 LIA-27-SLG LIARIALGLIVVVFGGVVLTGAGLAVQIAASLG 50 5 10%
5367 ALI-24-GIA ALIKGQIENFQPNFGVTELGVVTYIGDGIA 55 12 22%
5368 LAK-26-LSL LAKGHPGAQVRDDALSKARFEFRWEDQFNLSL 47 17 36%
5369 GVL-26-PLL GVLTALVDNVIQRALKLVLLLGMMRDDLGPLL 52 6 12%
5370 VIA-26-RLL VIADHIRTLSFAIGDGALPGNEGRGYVLRRLL 47 22 47%
5371 IAG-24-GIT IAGAAMLAAPVIWVLCSEIQGLKIRAFGIT 35 6 17%
5372 GVI-26-LSA GVIGALLATTMRGLENDVYFQVGLLTVIGLSA 39 16 41%
5373 LAT-28-GIL LATITFAIIGLLGYLINGLEGALLVLIAALGGIL 41 11 27%
5374 GVG-29-LGI GVGRKTANVVISVGFDEPALAVDTHVERVAKRLGI 46 9 20%
5375 TIA-28-YGL TIAQEEIFGPVLSVIPYDTEDEAIAIANDTKYGL 27 20 74%
5376 FLG-28-LLF FLGPLLLSAVGTMDPGVLIWSLGGGLAGILGLLF 40 12 30%
5377 DLL-29-ILL DLLFTFNIALSIASLGIAMEAALTLAFAGFPTILL 43 14 33%
5378 LAE-24-IAS LAEALAGDGVTAALAALAVEFPRALALIAS 43 4 9%
5379 LGA-28-GIV LGATITLAPITAPAEDVRGALALVERSEAPLGIV 46 8 17%
5380 RLL-26-LDV RLLRRVRDFAAVEGDGTILRVIADKALIMLDV 43 22 51%
5381 GAL-29-VIV GALLPSAAPLTAPIIGVLLDGAALPAAGELLDVIV 41 11 27%
5382 TLA-26-GVI TLAGVLSIPLLLPDGSLFPARYLLVFLAAGVI 40 13 33%
5383 LPL-25-LLF LPLPAVAGLAVALVVLQAAAALLHSLESLLF 44 7 16%
5384 ELV-27-EGL ELVKEVAKKTDDVAADLTTLATVEAGALVREGL 40 9 23%
5385 DLV-25-LDV DLVAMCVNDLVVQGAEPLFFLDYYATGKLDV 36 19 53%
5386 IDL-26-GLD IDLDIPAGEFVAIVGPSGCGKSTLLRLLAGLD 36 20 56%
5387 ITA-29-LAI ITASLVKELRDRTGAGMMDCKKALTEANGDIELAI 36 9 25%
5388 LDV-26-ALA LDVAEAIGHLALVLLEAVTAAASLDDELAALA 58 9 16%
5389 IAL-24-VIA IALFVFAAAAAFVALRGVVLAFGHLGLVIA 57 7 12%
5390 LLI-24-GLV LLIFGISIALPIAFGGFRLSVLNSTLLGLV 56 7 13%
5391 LVG-28-GVI LVGYLLAGVLAGPFTPGFVADTKLAPELAELGVI 44 15 34%
5392 AGI-29-TLL AGILILLINIVGGLLVGVGQHGMSVALAAEIYTLL 57 16 28%
5393 GAL-25-GGG GALSTKYNDTPEKASRTYDAVRDGFVGGGGG 61 14 23%
5394 DAL-29-AVL DALLAASLALLLLAVFALAGGTVVLILADVDEAVL 68 12 18%
5395 LDA-24-LIG LDASAVHPEAYPVVRRIAAATGKDIAALIG 40 14 35%
5396 LDA-26-DLA LDAVETAQALGLLAVLSHRSGETEDFIIADLA 54 10 19%
5397 DIV-27-LGL DIVDVFRRSEALDDVAREFISHEAKSFAAQLGL 39 15 38%
5399 LLV-24-IVL LLVLDATTGQNGLSQALVFLEVVNVTGIVL 54 14 26%
5400 LTL-29-LAI LTLTALLIARLLGAAGAGIRDAEFILTAPLLRLAI 54 6 11%
5401 LIE-27-LLA LIERNAQLAAELAETGQGTIAGFGDASDAELLA 52 7 13%
5402 VGL-29-EVL VGLADEEGSYPPQLSGGMKQRVAIARALANDPEVL 43 29 67%
5403 AIV-28-LIA AIVEGLAQRIVNGDVPEGLKDKRLLSLDMGALIA 52 24 46%
5404 GAI-24-VLA GAIVIIALAVEAGLSIASLGHAAVAIAVLA 57 5 9%
5405 NLA-28-LLD NLAGLMDGYFHAEAYIEGGLHLNVNVDGEEMLLD 38 10 26%
5406 LSL-29-ASL LSLNSIDVLSGLLTLKICLAYDLDGERIDEFPASL 63 14 22%
5407 LSA-27-ALV LSAASMALFANLLSEVVAIADILGDLTATIALV 61 6 10%
5408 LAI-26-ALG LAIMVLPSISAVSREAFRARPTALGEGALALG 71 17 24%
5409 IGA-24-VLL IGAPPGSVGFAAGGLLTEAVRGLPYSVVLL 61 15 25%
5410 VLT-29-GIS VLTFLRDIGKHFSVAQMIIKEADKLRLGRTDQGIS 35 7 20%
5411 DVI-28-ISG DVIAEPYRERLLPGFAMARQALANGGAVAAGISG 30 12 40%
5412 ELL-27-LVA ELLAQLRLGTEDVLVGIGLLREGLDLPEVSLVA 58 9 16%
5413 LVA-29-LAT LVAEIAGLLQALATATGRNLQGLVARALVAAALAT 58 16 28%
5414 VIA-26-GLL VIAGFPALFISMFFTGSLLIEAVFSLIGLGLL 58 12 21%
5415 GID-29-VLL GIDLSIWQLIELVLTLMVTSKGIAGVPGVSFVVLL 34 12 35%
5416 EIV-26-IPL EIVAGALQDHKRATKVGTQSFGKGSVQTIIPL 28 11 39%
5417 LGI-25-IGA LGIKKGDRVAIYLPNCPEAIVAMFALARIGA 50 24 48%
5418 VLG-28-EAI VLGSGPIRIGQGVEFDYATVHSVKAIQEAGYEAI 42 23 55%
5419 LGG-29-IGL LGGLVFGALGDKLGRQKILAITILIMAISTFCIGL 50 22 44%
5420 GGG-28-LLE GGGMFVTFLKAQGFEIGLSLLEEDKLEVAKDLLE 52 18 35%
5421 EIL-27-VLL EILKDERERQEAALNAIQVLLSLGSLEGELVLL 43 4 9%
5422 ATL-28-LAT ATLAATLDVPTQTDLMLGGGSALATLPLIAALAT 52 13 25%
5423 ISG-28-IAL ISGFLGGDGGAEVADLIDFLFALTTILGGGKIAL 41 7 17%
5424 GLL-29-LDG GLLEGLAAENALLFAGRLARATLFGLLGLAIFLDG 46 6 13%
5425 GLI-26-GGS GLIRANSSANLFELNASGGIFGKAAGLNSGGS 39 6 15%
5426 VLV-27-TLG VLVIGVATLLLLSQVVVAVKDRHLDLVVLRTLG 40 14 35%
5427 LIE-28-LLE LIEKGETREEAIDLVQPKTAYSWDEIVDVKELLE 50 9 18%
5428 GAL-28-LLR GALLVALGVGLLVTIREALDEGVDTGGGKATLLR 55 5 9%
5429 IAG-25-GGI IAGYTMISGAALRVEIEALGAASLMAILGGI 38 7 18%
5430 LIV-29-ISA LIVGRGGGSLEDLWAFNEEIVARAIAASEIPIISA 36 18 50%
5431 EAI-26-LSA EAIALGEKEAAAIMFGGGIIDATLALEALLSA 45 5 11%
5432 GVV-26-GAG GVVGVGLGGFTATEEAGAKAAASDYAFSGGAG 53 6 11%
5433 IVV-24-ALL IVVGLFEPLILGAIAELLDGIAGLIASALL 50 14 28%
5434 FGL-29-SLG FGLPAEQAAIDNGNDPAEFTYKNINGFRRQIKSLG 38 18 47%
5435 YLL-25-LAA YLLAAQLLGLAPAECLVVEDAPAGVLAALAA 48 12 25%
5436 SLL-28-LLD SLLESLPTLLSGGAIGVVAFARALLGIADVLLLD 60 13 22%
5437 DLL-24-NLL DLLNIPANYKVLFCQGGAREQFAAVPLNLL 39 11 28%
5438 LSA-26-ELI LSAREEDLDKILGLTAGADDYVTKPFNPLELI 37 11 30%
5439 GLS-27-LLK GLSKSQTFFRLVLPQAWRHALPGLGNLWLVLLK 46 19 41%
5440 VSL-24-DVI VSLGAIERALAAGADPQLIPDDIDATADVI 31 6 19%
5441 LIV-27-ILA LIVIAYLGLILGTALALRLAEVGLIGRQLKILA 45 17 38%
5442 EIL-24-LAS EILEALQEPLTGIVSAVMVALEQCPPELAS 42 12 29%
5443 EIL-27-LSA EILTRLRENNPHPTTELNFSSPFELLIAVLLSA 39 13 33%
5445 ATL-29-IAT ATLVVNTLGGIVFVAAVKAPGSGDRRKAMLGDIAT 38 9 24%
5446 VID-24-LTL VIDSLDRALEIADKAAPDMAAMVEGIELTL 32 7 22%
5447 VIE-25-GLA VIEILNRRTKNNPVLIGEPGVGKTAVVEGLA 36 24 67%
5448 ALA-24-AIS ALATAVGAYLGALVSHALHTPLMSVTNAIS 58 9 16%
5449 EAL-29-ELV EALLAAGSGLASKPAVDRLMLELLYAAGLRVSELV 57 12 21%
5450 ILA-24-GLL ILADKLLAKLFDAAALLGLALALAGLLGLL 73 7 10%
5451 ALG-29-LVS ALGLASAAVAGLSVADIILADALALLGARGVFLVS 50 2 4%
5452 AIA-25-ITL AIAASITGLAISLILGWLGLIIIILQGGITL 42 5 12%
5453 AAL-25-VIE AALVPLIIAAAPFYARQVEVALRELDKGVIE 44 16 36%
5454 GVL-27-LVI GVLYHRRSPLGLLLILVDLLVIGGELVLETLVI 41 9 22%
5455 GIG-25-NLL GIGLAMVAAAKGYKAILVMPDTMSQERRNLL 35 14 40%
5456 LLP-26-LLE LLPDDDRRDEVVLVAAIRIAAYDLSERPALLE 50 7 14%
5457 VSG-27-GAL VSGVARTIMAAELAAPHAQAVTAAAVVLRQGAL 49 7 14%
5458 VVS-24-TLG VVSSGAGLFSGMLLDKIADTAEKGLAATLG 36 6 17%
5459 SGI-26-GAS SGIRLSVINALIALVNAGVYPLIPAKGSVGAS 33 15 45%
5460 LLG-27-LGF LLGLLAYLGILLGGLGGLLAARVVIDVLVTLGF 52 5 10%
5461 GLA-25-IEA GLALQGSLLIFAGGVLLAAFRPALVAALIEA 44 6 14%
5462 LPL-26-GAS LPLANIPVGTVVHNIELKPGKGAQLARAAGAS 38 15 39%
5463 PLL-25-IVG PLLIGYTGGKLVGGERGGVVGAITTMGVIVG 40 16 40%
5464 IPL-29-GAS IPLYARVEIAHKHGADLFMSIHADGFTNPKAAGAS 31 9 29%
5465 LLL-24-LEL LLLARLFLKPSNLLILDEPTNDLDVETLEL 63 24 38%
5466 AIL-28-ALI AILPSLMKAAIKRMISANIAILSSARPAIISALI 61 12 20%
5467 VLA-26-PLL VLAGGGALLAGALLALILLTALIVGGDLLPLL 64 5 8%
5468 VLV-24-LVL VLVLVLSLVLGLSRALLLVLVLGEILVLVL 64 9 14%
5469 ELL-25-GIA ELLETVGLNPEHANRYPHEFSGGQRQRIGIA 47 29 62%
5470 VLL-26-GDL VLLLPDRIDEWLLVYLIEFDAAVFVVVARGDL 43 7 16%
5471 LIG-24-IAS LIGGTWYGGEMKKGMFSMMNYLLPLKGIAS 40 12 30%
5472 VLG-24-GSG VLGGDIAGEPVVADLAKMPHLLVAGTTGSG 41 13 32%
5473 LVA-27-IVA LVAAIDAASAAAILAGVLAPLAATIALAALIVA 53 6 11%
5474 LTG-29-DLV LTGKLTQLFRDDAKAKLEALGAKVTGSVSKKTDLV 38 17 45%
5475 TLI-29-LLN TLILGFLALNYLLILTKIISGKEFRILYVGIALLN 36 3 8%
5476 LDA-27-NAL LDAGSTLLEAVPLLRRFPGITVATNSLDIVNAL 37 7 19%
5477 ILD-26-LVS ILDEPTNDLDIETLELLEELLDGYQGTVLLVS 40 22 55%
5478 FGL-29-LLG FGLFQEGNAPKAITSAPRRRSGAAGGMLGTLRLLG 51 18 35%
5479 LVL-25-TGL LVLGGLNLVFIAILAAKLLVDLALHARVTGL 49 6 12%
5480 LGI-26-GAI LGIRKGDRVALFLDNLPEFIGALFGLAKIGAI 50 9 18%
5481 ALS-27-GEI ALSHNKEDLEKRAGAILIVRGTSPVRFTSDGEI 36 16 44%
5482 AIA-27-LEV AIARALAMEPEALLFDEPTSALDPEMVNEVLEV 40 10 25%
5483 LGG-24-TLG LGGGVELATICDLRLAEISALNGRPEITLG 44 21 48%
5484 EVL-29-LGA EVLAGLRMADATLPVLMLTARDGVGDRVLGLTLGA 44 9 20%
5485 LSV-29-VGL LSVLDNVALAPRAVKKLPKAEARRLALALLERVGL 45 20 44%
5486 GGI-27-IAA GGIDGRFALLRIMGIGTVMIAGDNLLTAAAIAA 47 9 19%
5487 IGV-26-IGA IGVMGGNPETTTGGNALKFYASVRLDIRRIGA 39 12 31%
5488 TLG-29-SLG TLGATRWRVFFTITLPLLLPGIIAGTVLAFARSLG 41 25 61%
5489 SIA-26-LLS SIAQSLLCTKMKRLCLQIQEIAIPDEALELLS 43 12 28%
5490 ALE-27-LDA ALELVKQAHEPALVALESANRHTVATGDSILDA 54 15 28%
5491 ALV-24-LIG ALVVLVVFLFLRNGIATIIPAVAVPLSLIG 60 16 27%
5492 LIV-27-EGL LIVAFVGKGAWIYLVPKQLLLAGIAAYGELEGL 34 13 38%
5493 LVI-26-ITL LVIALARLSARSAAGSAKPGIFVWLFSLVITL 34 13 38%
5494 DLA-25-ILD DLATHRLYDGDEERVKGDVGLAGVALDSILD 44 8 18%
5495 LLS-28-GIS LLSVVAAVSACGASGVAGGSLLLIPLACSLFGIS 47 16 34%
5496 ALV-29-GSL ALVLAALAVGLMLGAPLAAVLVAAGAALVGILGSL 52 9 17%
5497 ALV-24-GFL ALVSNARLLLLDEPTNHLDAEAIDALVGFL 44 10 23%
5498 LAA-24-VAI LAARPAVGKTAFALNIAQLLGTKAALTVAI 65 12 18%
5499 IAG-24-GVG IAGLELITSGDLFIGGRRMNDGPPAERGVG 41 10 24%
5500 VLI-29-LAL VLIALGIILGLGLAAALALAALAVAGVLLLLFLAL 61 2 3%
5501 GIA-26-SVL GIAYNKEEFFEIVERGLDASPTTEVLIEESVL 40 18 45%
5502 LLP-28-VLT LLPALSAATVAAGEDLVEASLVEITNRFERSVLT 45 6 13%
5503 LVI-25-GVV LVINGEKTVLHLIPSGILRENVLCIIGNGVV 37 21 57%
5504 LDA-24-LLE LDANNRILFAQGLRRRAAAGDREGIEALLE 56 8 14%
5505 IVS-26-IVL IVSAPLPELSLNIIDRYLVACETLPIEPLIVL 34 9 26%
5506 GID-28-LAI GIDAHCFNELFLRFQRRDVARERADGGRGLGLAI 35 14 40%
5507 LLI-27-LGT LLIAIFLQSVGELEILATGILGDGAGALPILGT 44 6 14%
5508 LIG-25-ILL LIGAPPGYVGYEEGGQLTEAVRRKPYSVILL 60 29 48%
5509 AIL-24-AAI AILRYLGREKTFSEGYTATTNNRMELMAAI 53 10 19%
5510 AIL-29-LGT AILPLRGKILNVEKARLDKILSNEEIRSIITALGT 39 19 49%
5511 LLT-26-GLV LLTDGRFSGGTSLLSIGHASPEAAVAGAIGLV 54 13 24%
5512 VLS-26-ALT VLSDGLLYMTNNAEELLAQAGVAGYGISLALT 45 6 13%
5514 ASL-28-ALV ASLAQLVPRLAVLLIPALAARGAGGLISASRALV 64 3 5%
5515 GLV-26-ILL GLVLLLGLAGFAGALALAIISGSLLGGSGILL 56 7 13%
5516 VIA-24-LSL VIATGNGVSLLGTVLLLEAQLDRFLLILSL 52 8 15%
5517 GIA-28-AIS GIAMGVGYDVAGETAAIDLGRASLGGLAAALAIS 36 6 17%
5518 LTG-24-DAL LTGMMMTLKGLPLAYNKVMQEDKEALFDAL 50 8 16%
5519 IVG-26-EIL IVGEGGIGKATAKRSVFGLVDIDMIAGPSEIL 39 8 21%
5520 VDL-25-AIA VDLNTIPIAAIEAIEVLKDGASAQYGSDAIA 46 13 28%
5521 LNA-27-GEL LNATQVTAISTTQVKGLTASQLKGLGTTDIGEL 32 8 25%
5522 LAI-24-ALS LAILQAIAEVRALNGITGPCFVGKDTLALS 56 13 23%
5523 ILG-25-LVF ILGLRAGYFLLAAMADRFSRLKYALAVILVF 34 12 35%
5524 LTG-29-LGL LTGGQARVAGAASFSGAAALAVRSLEIAPDALLGL 70 6 9%
5525 LVI-28-VDL LVIEAETNGTIDPEEAIRRAATILAEQLEAFVDL 35 15 43%
5526 LDI-25-LTL LDIALGAGGLPMGRIVEIYGPESSGKTTLTL 35 20 57%
5527 LGT-24-KLA LGTAACPPYHIAFVIGGTSAETNLKTVKLA 34 18 53%
5528 IVD-25-EVL IVDSYIKWRISDFSRYYLATGGGDISQAEVL 33 9 27%
5529 ADL-29-LSG ADLSGANLRGADLPGADLSAANLSDADLSGANLSG 57 17 30%
5530 GLL-26-LGS GLLATAATAALLATLALLARFASGCAIALLGS 52 7 13%
5531 SAL-29-VLV SALLFDQRGALKRMMAIHQTAEPTVLQMESLKVLV 57 14 25%
5532 SLA-29-LSA SLAVFARRNLYGFLETPYRKVLDGDVTDDVVYLSA 61 18 30%
5533 VLS-29-GVL VLSALLGALAALADRLLLDGGVERLLNPSDKRGVL 45 11 24%
5534 IVL-29-LLE IVLADHKGDTITARLILRLLSLGLSDTGHYLLLLE 40 5 13%
5535 TLA-26-GSG TLALGKDIAGLPSITDLAKMPHLLVAGTTGSG 43 11 26%
5536 IAS-24-EIA IASALHLGSPLRAFNSLNRIGASALSNEIA 35 13 37%
5537 GKL-25-LGL GKLSLNDASLFYEPEPSAALGFGFRCGFLGL 47 18 38%
5538 TLI-25-LTL TLIPAIAVPVSLIGTFAALYLFGFSINTLTL 40 24 60%
5539 LFG-29-GLS LFGIVQGGEYEDLREQSAKDLVSLDFPGYAIGGLS 39 21 54%
5540 EVI-28-ELV EVIDRCWQLGDKNPILFIHDVGAGGLSNAMPELV 34 17 50%
5541 LTI-26-LTG LTIALHYVFDSPKDKLIWDVGHQSYPHKILTG 36 22 61%
5542 GLF-28-EGL GLFVKELEHALLEGEIDIAVHSMKDVPTVLPEGL 28 20 71%
5543 NLL-24-ALL NLLRLLPLPLAIKALLALRLLEMGHARALL 60 11 18%
5544 LVL-26-ITA LVLLAFAFLNAFIAGADGPDAFFGASGALITA 48 14 29%
5545 AIA-25-GIE AIAEAAERVTAEGKGKVPVVNPNLMAALGIE 37 7 19%
5546 GVL-25-GSL GVLTSVHAFAADPARGLFILIFLGLVVGGSL 47 18 38%
5547 GVL-25-GEL GVLLHRGYPIEQLAEVGDFLEVTYLLLVGEL 42 10 24%
5548 LVV-28-VSG LVVFANAVEDNPFMAGAFHGVGEADVVINVGVSG 42 13 31%
5549 LDA-24-ATL LDALLIAQAELLRGNALGEVAALLVDDATL 45 2 4%
5550 VEL-29-LVE VELSDGYDKHIHDQSERRFVVELDLEKAGLAELVE 39 8 21%
5551 SGV-27-IAL SGVDKYIASLMHETNGSPLLMLWSIALVLRIAL 39 9 23%
5552 RLI-25-VLL RLIGAPPGYVGFDQGGLLTDAVDKHPHAVLL 47 28 60%
5553 VSV-24-LAL VSVLGAVSLSLFAAHALMLLLLLSLASLAL 50 8 16%
5554 VIE-24-IVL VIESFLDKGRGPVATVLVQEGTLGKGDIVL 30 12 40%
5555 LGL-28-LEL LGLDAGLSLMAAKILLPLAKAVIVEEDRKAHLEL 53 8 15%
5557 VLL-27-IGS VLLGQFLPVIAPYAGFMAGMKAFTAAVLGGIGS 39 9 23%
5558 LVL-29-TIA LVLSAPEVIKAIHNAYFEAGADIIETNTFNSTTIA 41 10 24%
5559 LLD-27-RLI LLDELEKAAGGSDNAQIQVLDAGELIDEGGRLI 40 9 23%
5560 ALI-25-LLE ALIGFAGPRVIEQTIREKLPEGFQRSEFLLE 64 21 33%
5562 DLL-25-LSV DLLARVEAPGLELDLAEVGKYLDLPLAYLSV 38 10 26%
5563 LGV-26-LAE LGVRLLERKTRRLSLTDDGRSLAVRARRKLAE 61 12 20%
5564 SAL-29-SLA SALALLLGLLLSAEFQALASALGQLADGAALPSLA 56 7 13%
5565 GLG-26-ALI GLGLISGLVFVGWLSAVGGLVLQAAALILALI 59 7 12%
5566 LAE-28-ELI LAERSSVISGGGEDAQIDRAAASDARLAGIEELI 49 12 24%
5567 LGG-27-KLA LGGLGVLGLAIAKGVNPAAVIATDLLDTKLKLA 38 18 47%
5568 LDL-27-GFL LDLILNEDSGLLFVGRSKIISEIRDYLDQEGFL 32 13 41%
5569 GVL-26-GVV GVLLAVPGADFVLHNSLFLIAHFHNVIIGGVV 47 16 34%
5570 LVV-25-GLD LVVNNGGLEITSTPNQDSPLTEGKTPLLGLD 38 11 29%
5571 GGG-27-DLL GGGMFVTFSKAQGFSDPLSLLLEDHPDSQKDLL 41 24 59%
5572 ELV-29-VIG ELVQISGLSHGTDVWLLNALELIRNGGCELSAVIG 34 10 29%
5573 AIV-25-LGS AIVEGLIPLILAGIVAELLALSVLRSLDLGS 38 11 29%
5574 LDA-28-AIA LDALAAATAAGLALRLAALPAQLARLRAQRAAIA 56 5 9%
5575 LLV-26-LLN LLVLIINAALEGDLTFRLAMAKLREVGVTLLN 44 7 16%
5576 TLL-26-IDL TLLCALFVKHFRALVKAGHVYVALPPLYRIDL 36 12 33%
5577 LAS-28-ILA LASQEVHDISVAIGIDPGSDDLSQLRYGKICILA 54 19 35%
5578 EVL-25-ATL EVLEQDLQAELKEAGVDEAAEAALPDAWATL 38 6 16%
5579 VIL-29-LLE VILQMTALGLGDIAAFPFVEAPDKRNIQDGVRLLE 40 13 33%
5580 VIL-28-GLA VILVPVLLEPCGLTQSYGLKYGLLLLVRATGGLA 45 15 33%
5581 ELI-27-VSL ELIVMAMQALLNNGDEVLVPAPDYPLWTAAVSL 34 18 53%
5582 ELI-24-AKL ELIRKGFETLSELGGKLIAAAAEFLDLAKL 32 3 9%
5583 GVI-25-GIS GVIHSWLNRMLLPDTVGTGGDSHTRFPIGIS 36 19 53%
5584 LAT-29-LGT LATGIAIGGVDVTGLKPALLLGFLVVQAVAGVLGT 38 12 32%
5585 TLG-28-IGG TLGQEFSGYARQLEAGIERILESLEHLLELAIGG 36 16 44%
5586 IAD-26-TLG IADKVYIEPITLEFVARIIRKERPDALLPTLG 31 21 68%
5587 VIE-25-VLV VIEALGAGNLPPKALKGIARLIFGNIPVVLV 35 16 46%
5588 ELL-24-VLL ELLLGVGIPIEQHYGLMSEVAPGWKLRVLL 62 17 27%
5589 ALG-28-ILL ALGAFGTFLVIMSLVGLAVILGLEKANVVGGILL 59 10 17%
5590 AGL-24-ILA AGLFYLLLLTDLGKVFVTASFAVIGEIILA 64 9 14%
5592 RLL-28-DLL RLLRQPELTLLTLSGASLSFLLAAALLEEAGDLL 56 11 20%
5594 IAL-29-LEA IALALALAADFAKASVGLGAGIKGIGARDAAILEA 44 4 9%
5595 LGG-26-GLI LGGGLELALAAAFAAAAEEAKLGLGELLLGLI 52 14 27%
5596 IAA-26-LIG IAAVLAGIGLNEGILGRILGTLLGGALPTLIG 59 10 17%
5597 LVE-27-ILV LVEDLVNRSIEPLKVALKDAGLSVSDINDVILV 34 26 76%
5598 GAL-27-EGL GALTRRLAGNADKSGTGGVEPAALTLDDAREGL 47 7 15%
5599 LPL-28-AVL LPLMLLARLFIGSVLQLACIFRRDGVADLLLAVL 61 13 21%
5600 SGG-29-ALE SGGELARVLAAGGDAALEMFQGVKAKRREVLRALE 41 10 24%
5601 GIV-26-LIG GIVYSRSLRLAGDKRDEGIISYIRRKGNLLIG 45 14 31%
5602 EGL-24-AAL EGLAAQQQKLALPSVAMLVGPITAATGAAL 62 17 27%
5603 VEL-28-ILA VELVIDAAEGARLTPDDEAVLTDGRGEKADEILA 39 6 15%
5604 EIV-29-DAI EIVWRQPFPGPGLAERVEGSITEEKLEDVRLSDAI 33 11 33%
5605 IPL-24-AKL IPLVFLQNITGFMVGRKYEAGGIAKHGAKL 31 15 48%
5606 IVD-28-IVG IVDYSPQQEGKVFFGAWVEIENDAGATLRLRIVG 29 12 41%
5607 VLL-28-SGI VLLGNNGLLELSRLLQRPQILLEMLNELGLCSGI 41 7 17%
5608 LPL-27-GGG LPLLVPMIGVGLAIAAISAILFFAIIASLTGGG 42 9 21%
5609 VSV-27-AVL VSVTERTAEIGIRMAVGARASDILQQFLIEAVL 41 14 34%
5610 FGL-28-AAI FGLGVFKVLEVVEAVERVPRAIGLGYRSIAIAAI 43 8 19%
5611 LGV-29-DIL LGVSAGLLAADLSDAEEVKLAIAATLGGLGIADIL 39 2 5%
5612 IAV-24-EIA IAVAAAGALLFGARAFATDLIVGATEEEIA 36 3 8%
5613 ITL-29-VLD ITLCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLD 30 19 63%
5614 EVI-29-DLI EVIREELELIREQFGDARRTEITANSADINIEDLI 31 16 52%
5615 LNA-29-GIA LNAAYLADGYARANGLAALGTTFGVGELAALNGIA 34 10 29%
5616 ALL-29-GLF ALLATGGAVLLGGLAFGAFILLVALAILLLGYGLF 60 13 22%
5617 DLL-29-AAI DLLPGLVGLADEAQGADLAKYSLLAGLADAVAAAI 45 5 11%
5618 GLS-27-GAL GLSALILYLLLLDISDVLGVTIAWAIVILSGAL 61 9 15%
5619 VAL-29-LVD VALYLEQDDAGKGVLAALPAAAGQGLELGVRRLVD 47 7 15%
5620 IAA-26-IVG IAADNAIFGQTGPKVGSFDGGWGASYLARIVG 48 19 40%
5621 AGI-25-RLL AGILCIEFTIGFGPKIAVRRAAETRIANRLL 50 12 24%
5622 DAL-25-LLN DALKVVSKGVNEMRGEGFGALIITHYQRLLN 39 24 62%
5623 IGA-28-LEV IGAVVDVEFPQDAVPRVYNALEVQNGLERLVLEV 36 16 44%
5624 ILV-28-GLV ILVLIIAFFAGLEGILDEFQVHQPLVACTLIGLV 42 12 29%
5625 LEV-24-VGI LEVVPILNKIDLPAADPERVAEEIEDIVGI 29 12 41%
5626 ITA-29-LGL ITAFVGGLYALFAHNIQDLLAYVTAKMIAIILLGL 43 6 14%
5627 GIE-26-LLI GIENYSRHLSGRKPGEPPKTLFDYFPEDFLLI 30 12 40%
5628 IAL-24-SLA IALLAAILASGGGAGILGATLSIGGALSLA 67 8 12%
5629 ALI-27-LLD ALIALGAVGAQGALAPDAPVDALDMARAAALLD 50 2 4%
5630 AIL-25-IAD AILDMRLRRLTGLERDKIQSEYDDLLALIAD 37 21 57%
5631 LAS-25-ILD LASRFKNICVVGDADQSILGWRGADVQNILD 37 12 32%
5632 SLA-25-LVG SLAPGSKVVTDYLAKAGLTPYLDALGFNLVG 55 31 56%
5633 LGA-28-YLL LGANLVLTEGAKGMKGAIQKAEEIVASLPLKYLL 38 10 26%
5634 EIA-26-GVI EIAYIQEAVETPERIFVAILGGSKVSDKIGVI 34 9 26%
5635 IVA-25-TLG IVAVIASNIIGTAEMVVTVGSGDIAIARTLG 40 5 13%
5636 DIL-29-VSG DILIDGGNTFYKDTIRRNKELAESGINFIGMGVSG 32 21 66%
5637 IEL-27-LLS IELFEDGDGEKPDAALTAVIVALARDRGLILLS 40 7 18%
5638 EVI-28-GVV EVIGFKLTGKLPEGATATDLVLTVTQMLRKKGVV 33 19 58%
5639 LDI-26-VLA LDIYMIVAVDFFNMGAMENKGLNIFNSKYVLA 36 20 56%
5640 TIA-24-DLA TIAKRKASLIGANAIAPALPELIGGSADLA 33 6 18%
5641 ALA-29-ITA ALAAAGASAAKVGIGPGSIATTRIVAGVGVPQITA 65 10 15%
5642 SGL-29-LGA SGLSATIAENIGGYREEVGATDSRAELEKALRLGA 56 15 27%
5643 VEL-25-ILL VELHIPGDILAPHLGEGKAPSIGGSLSLILL 39 6 15%
5644 IGV-27-EAI IGVINFAYYLAKNGKRYSDGSANNLTHKTFEAI 32 15 47%
5645 NAL-28-AIG NALSPAKVLKVIVDEEEESTTVVVPDYQLSLAIG 36 20 56%
5646 FLA-28-LLG FLAGLVITILIRLSRGLRASLAGAKSLLLLSLLG 54 13 24%
5647 LSL-29-IGA LSLATLGVLITAGLTGMGAAALFNLGLILGLLIGA 50 9 18%
5648 ELA-27-LNA ELAYLVAEAEEAGITGTNGKTTTTAGIALLLNA 40 8 20%
5649 LAA-28-IVD LAAEFLDSLADLGLAGGGTGIRGMAELFLQIIVD 44 17 39%
5650 DAL-26-LSV DALTGLLLRRASKRLLDELLIVVAASLLLLSV 47 5 11%
5651 VLI-26-GLG VLILDELTALLGVAQGLLVLKAIAAARALGLG 41 5 12%
5652 KLA-25-EVL KLAVKYHPDLNPGDAEAEAKFKEVNEAYEVL 43 11 26%
5653 LPL-24-GLD LPLPALGIVVGALLYHAGRSDALLLELGLD 42 10 24%
5654 PLL-24-LGI PLLVLLLLKLALLEKSGLNLAVAALAELGI 52 4 8%
5655 LDG-27-LVL LDGSTLYQSIAADFIAQGYGIDLSDRQEIGLVL 42 11 26%
5657 VLL-27-SAI VLLAHLVLALRYNTLTLLESIALSVAAVLSSAI 42 10 24%
5658 TLL-25-DIV TLLLEHCKPDLIINTGSAGGLAPELKVGDIV 33 11 33%
5659 AIA-29-AGI AIALAASTGLLDVPADLLLSLLGQSLLALLLGAGI 60 6 10%
5660 LGV-27-ALE LGVKEEEVKNEASFVDDLGADSLDTVELVMALE 57 23 40%
5661 AGL-25-GAS AGLALAGVAAQTLLRNPLADPYALGVAAGAS 64 10 16%
5662 LGA-29-PLL LGAIWKFPYIAGQGGGGAFPLIALLFTLLLGLPLL 58 13 22%
5663 IGL-29-DVI IGLGIMGGPMSKNLIKANYSLVTKDRNIEAIADVI 31 6 19%
5664 LDL-24-LGY LDLLGQHLGVPVAELLGPGQQRDAVEMLGY 31 18 58%
5665 LVA-28-LVD LVADARMSTPEGGDEIAQGLVETALDAGANGLVD 47 9 19%
5666 VSL-28-ALI VSLAVAGGRALQAELGFLLFIIGPLPAAALGALI 43 9 21%
5667 GGG-24-SLL GGGVIGDLAGFVAAIVLRGVNFVQIPTSLL 48 15 31%
5668 GIA-29-LLR GIARALTWEPFRLLLDEQASALDDEFTIHALVLLR 46 28 61%
5669 LGS-28-GIA LGSNGSTSMGSVCASTLSLANAGVPLAAPVAGIA 38 8 21%
5670 LDA-28-ALS LDAASALLLGAALLSLFQNGTAATNSLAIVNALS 53 6 11%
5671 FLA-27-GEL FLARRRHLQALIQAAEHLQQGKAQLLGAWAGEL 33 9 27%
5672 GDL-25-EGL GDLAWAAGDQQARGFLIGGTSGRTTLNGEGL 32 23 72%
5673 TLL-25-AIV TLLAIYALALLVAALLKLGLAVALALVAAIV 47 7 15%
5674 LAE-28-FGL LAEAEVEYHDKNSPWIDVAFPAADLAALAAAFGL 35 8 23%
5675 IGL-29-LLF IGLALLLGILAAGLILEKGLLRSVGGGIVYVGLLF 47 4 9%
5676 VVL-27-VLS VVLVAIAALLELGLAPLVAALASTRAVGFGVLS 47 5 11%
5677 SGL-26-AIE SGLYTWLPTGQRVLKKVENIVREEMNNAGAIE 38 12 32%
5678 TLA-27-AIS TLALLIGAGGLTSFILLGIDRNAASLILIGAIS 38 8 21%
5679 ELV-26-GLV ELVWVGRVMVLAVALIAIALAANPENRVLGLV 39 15 38%
5680 ATL-24-SLG ATLAAAAIIGALAEASPLGIAGPAVPASLG 45 2 4%
5681 VLT-28-LDV VLTGSAAGKSTRGEVLAVGKGRILENGTVKPLDV 35 17 49%
5682 ILD-28-LLV ILDPPFLFLAPDFIRLALKAIQEIVAEGGIPLLV 35 6 17%
5683 LEV-25-GVS LEVVMTVLHAGGKFDKFSYKVSGGLHGVGVS 34 14 41%
5684 GLL-29-ITL GLLHTKSVLVDGELSLVGAVNLDMRSLWLNFEITL 42 11 26%
5685 ILL-29-GIS ILLAVLIGALLGLAIGLAPLAGGILAALLILAGIS 41 3 7%
5686 SLA-29-LNA SLASLIALLTLAVYGVLVPLMVFFLLKDKAQMLNA 36 7 19%
5687 VAL-29-VLS VALFRLLESWGVRPDYVAGHSVGELAAAHVAGVLS 54 17 31%
5688 GLA-28-IGG GLAGVGVAARLAAATPNAGIGIELLGIAAVVIGG 56 22 39%
5689 IAG-24-VSV IAGCKAAVERAGAACKAAGAKRALPLPVSV 36 18 50%
5690 DAL-27-SVV DALVVMKGTLLGMPVVAAAFEFAFMGGSMGSVV 33 19 58%
5691 SGL-27-SVL SGLLLGILLSSAEALALLLLDSAVAVPFARSVL 40 3 8%
5692 LID-28-ELL LIDGNGAFGLIDGDAPAARRYTEALELKRAPELL 47 15 32%
5693 LVD-29-GVV LVDPLDGTKEFIKRNGEFTVNIALIEHGKPVLGVV 35 19 54%
5694 AIA-26-ALN AIAEAAEAIPDARDALIGVVAMTAQAAERALN 41 7 17%
5695 AIL-26-GEI AILDAILAQDPNARVACETTVTTGLVLVAGEI 36 29 81%
5696 DAL-24-IVD DALFVIDADHEHIAIKEANNLGIPVFAIVD 32 15 47%
5698 ILV-29-DAL ILVVDDHPAGERLLALPLDLLGYVVPTANDGVDAL 38 17 45%
5699 LDA-24-VIA LDAVFSLDAIATAVGMVLHLTVMMAAVVIA 43 11 26%
5700 VGI-26-LVI VGIDQTLVDIEAKVDDLFILRYGLGAGPSLVI 33 7 21%
5701 DAI-28-IAG DAIVIDTAHGHSAGVLRKIAEIRAAFPTRTLIAG 34 14 41%
5702 VIE-26-ELI VIEMAAASGLELVKPELRNPLITTSRGTGELI 40 17 43%
5703 VSV-29-AAL VSVGMLITPGALALQVLTLGELHARIRAIAGLAAL 53 7 13%
5704 LLL-28-GKL LLLAAPAGGKATLGLDPGLRTGVKLAVVDGTGKL 53 20 38%
5705 LLA-27-FGL LLAKRMGKLRIIAETGAGQHGVATATVAARFGL 65 16 25%
5706 VLA-27-VIG VLAVALTHGKTTALGMAAWILEALGYKPGFVIG 52 7 13%
5707 LAS-29-EVL LASYRELEAFTQFGSDLDTATQAKLNRGRRTVEVL 46 15 33%
5708 AVL-24-IGG AVLDASLHQAALADEVACTRLARASAAIGG 52 6 12%
5709 LGG-26-SGV LGGPPLVKAATGEHVSAEELGGADVHSRWSGV 42 12 29%
5710 VLE-24-ALE VLEIVRLEKPKGVIVQYGGQTPLKLARALE 47 15 32%
5711 TLA-29-LLS TLASKLGAGVNDLPGEASHVDANLGALEILLTLLS 56 13 23%
5712 LVI-29-ALL LVIATGAGGVGVLVAALLIEGLAALIAALLLAALL 63 4 6%
5713 GIV-26-GGG GIVSAVMVALEQCPPELASDISERGMVLTGGG 36 19 53%
5714 ELI-28-NVL ELIPRQQFDIAIQAAIGNKIIARSTVKALRKNVL 30 16 53%
5715 VAI-29-SAI VAIMHSGLSDGEKFDEWRKIKLGQAKVVVGARSAI 35 9 26%
5716 GGI-29-DAI GGISAALGNMHEDDWRWHMYDTVKGSDWLGDQDAI 35 22 63%
5717 LEV-29-LAI LEVKDLHVSFDTYAGEVQAVRGVSFDLNKGETLAI 33 22 67%
5718 LAK-25-GIA LAKARSIAAEMRRVRHIHFVGIGGASMGGIA 39 7 18%
5719 ALK-27-LAE ALKNIIAVGAGILHGLGYGDNAKAALITRGLAE 57 24 42%
5720 LIE-25-ALI LIEKAFREVAKKMDFQILEFNGEEDHVHALI 39 11 28%
5721 IGG-24-LGI IGGLKEVIQKVREMVELPLKHPELFERLGI 42 28 67%
5722 GGS-28-AIG GGSTRVPLVRERVGEFFGKTPLTSINPDEVVAIG 40 25 63%
5723 ILL-28-IAL ILLGAGIILVGLFVGIITVAQALSFSGLGGVIAL 60 14 23%
5724 LAK-27-AIS LAKRMGAKKVMVLIQRRAYVDLVQGRVIDIAIS 37 12 32%
5725 AVL-28-LLE AVLLAADELRDELVLPLQAADAALDTSGLPALLE 62 7 11%
5726 VLG-26-LSL VLGIDNLVFIAILADKLPPHQRDKARVIGLSL 59 11 19%
5727 LVG-27-ILD LVGERGVKLSGGQRQRIAIARAFLADAPILILD 35 17 49%
5728 SVL-29-LDI SVLEKLGNSVDVAMTGKAALEMFKPGEYDLVLLDI 31 8 26%
5729 SGG-28-ISA SGGEEGALNGPSIMPGGQKEAYELVAPILEGISA 33 21 64%
5730 IAS-27-IGG IASYRGSELFEIVGLDDDVVALCFGGSVSRIGG 35 10 29%
5731 AFL-26-GLF AFLAGVLLAESEYRHALESDIEPFKGLLLGLF 35 19 54%
5732 NAL-26-ELG NALRDGQLLGVELTREEDVDGGEIAKNLSELG 36 15 42%
5733 SGL-26-LDV SGLSKGISTAAHALALANGGKLIAVIGLGLDV 33 10 30%
5734 EIL-26-EVI EILEGKRHDHFPLDPIQGGSGTQSNMNVNEVI 34 14 41%
5735 TLI-25-ALL TLITAGAVVALAVRLTAAAAAILGLVLVALL 55 7 13%
5736 ISG-25-ASG ISGAGTGGAGGAAAAVVLNGLAVTALLAASG 36 2 6%
5737 LIA-28-DLV LIAGILAALDIQVEVELRGDRAEAYIGVEIPDLV 37 15 41%
5738 AAL-27-DLI AALGFGFRGGFLGLLHLEIIQERLERELSLDLI 50 10 20%
5739 LTL-26-TLG LTLLLAVAAVAGAAIHYCRSRYDLVAILKTLG 43 7 16%
5740 ALK-29-SGG ALKEYPDLFKEYFAKVIPPTDNKLAALNSAVWSGG 42 23 55%
5741 LAI-29-VAI LAIILIDARGGVLIQGIRASFFASLLGIKHLVVAI 45 9 20%
5742 LAI-27-GGI LAIVGFVARSARHAAPHAASLGFLDGAIFTGGI 41 12 29%
5743 GSL-28-VLA GSLLLWVLIGSGWTFAVAIFSRGLPLVIVARVLA 56 15 27%
5744 ILV-25-LVV ILVVAAADGPMPLTREHILLSASGLVPALVV 38 10 26%
5745 VEL-25-GLV VELTVAETKPIIKGATRRGSGKPATLETGLV 55 15 27%
5746 LVF-29-VLG LVFLVACIAGMGSILDELQFHRPLIACLLLGEVLG 36 9 25%
5747 LLL-28-VGK LLLAGCTTTVTHRFTKILEHHVENADLLVVAVGK 36 14 39%
5748 SLL-27-ASL SLLLVLAIILGAAGGLAGAAGLGLAFFALAASL 61 3 5%
5749 IAL-24-LGY IALGGAIGTGLFLGSAPVIQSAGPAVILGY 34 19 56%
5750 GLA-25-GIA GLALGALAEARGGLFEAVSGAAAAIAGAGIA 58 9 16%
5751 SVL-29-LVD SVLEMFISTHGARKGMADTALKTADSGYLTRRLVD 34 20 59%
5752 GGG-25-GLI GGGLELALACDARIAAEEAKLGLPEVGLGLI 40 16 40%
5753 GGG-26-LDV GGGFGHFYAYAPTKIEYAINRFTMELKRLLDV 37 13 35%
5754 LIV-24-LIG LIVCITEGIPIRDMLVLAGVLLASASRLIG 48 9 19%
5755 LIG-27-LGI LIGFWFKKPSAIAAALKAFLVNRVGDFGFLLGI 58 21 36%
5756 AIG-27-GAL AIGILAFLEGAAVIDAGSILALGFLLPLLAGAL 65 1 2%
5757 AIS-24-LLA AISATVAGVAKDGKLIGPLELLVEAQLLLA 61 7 11%
5758 SLL-25-LIV SLLLTQLGLALGLALALLADFLGLAALGLIV 54 5 9%
5759 ALE-27-GLG ALENVELPLLLRGEPKAEARARAKALLEQVGLG 48 25 52%
5761 LEL-26-VLV LELKAVRKGMASGVVIESFLDKGRGPVATVLV 37 25 68%
5762 IVL-25-ILL IVLCIIVFLFLILIRLIKHSIGLIVLAGILL 54 5 9%
5763 GAL-27-EVL GALAAQLGGMADVSKGTGVIVIRLAREALGEVL 45 7 16%
5764 LSV-29-SIA LSVAPDHLLIDAMVLALAIPQLILIKGAALSASIA 35 9 26%
5765 KLA-28-ELG KLASRLMPSAGWKGIIAVSRGGLVPAALLARELG 37 7 19%
5766 LPL-29-GSG LPLITVVCAIFGGVPFMALRDYFFAESGVGGTGSG 38 11 29%
5767 LLP-27-EGL LLPRWRGAAPVQQAILAGDNPTGNVVMIIEEGL 38 12 32%
5768 ISA-28-AIL ISAALTSFLTGITEPIEFSFMFVAPILYIIHAIL 37 9 24%
5769 GID-29-ELL GIDVGAKYEIYQLIAELAKKGKGIIIISSEMPELL 38 25 66%
5770 GDL-26-LTG GDLIAVEPGEKIPNDGGVAAGGGPVDESGLTG 36 9 25%
5771 VGK-27-LDI VGKTAIAEGLAQRIVQGDVPEVLADCTIYSLDI 29 23 79%
5772 ALL-24-VSV ALLAANGAGKSTFLGVAPSASILAAGTVSV 57 13 23%
5773 ALV-29-GIT ALVRKDGTHTAFVHFSNATPKGYTGSALYASIGIT 39 11 28%
5774 AGI-25-VIG AGIVLTARLGSGQPLAGVGVELDAIAAVVIG 47 20 43%
5775 KLA-29-GLL KLADEQIAELSMLCGFDDDLAAQTTQASNRIRGLL 44 11 25%
5776 GIL-29-LAL GILVIVLGLFLSLALVLIAILELFLIVILLAGLAL 62 4 6%
5777 GAG-27-VIV GAGLGGGHDEREQTLNQLLVEMDGFEGNEGVIV 39 15 38%
5778 ILD-24-LLR ILDVVKLTAQAGEIIELVGAGGTGKTTLLR 35 6 17%
5779 VEL-27-SVV VELILTRLHAGGKFSNKNYQFSGGLHGVGISVV 29 22 76%
5780 VVS-27-ILA VVSTMSAISASSRKIADIIGVIDGIAFQTNILA 36 10 28%
5781 GEI-28-ITL GEILGIAGLVGAGRLWIVETLFGIGRKSAGTITL 30 8 27%
5782 IEL-27-LLT IELAKWADLVLIAPATADLLARLAAGMANDLLT 35 9 26%
5783 SGV-24-SAI SGVFEGVTTGTSIGLLIENTDQRSIDYSAI 30 10 33%
5784 IAD-28-LLF IADEPTSALDVKVQAQILKLLSELAREGGMSLLF 30 11 37%
5785 YLL-25-VLE YLLKQLLEKPNVLLLDEPTNDLDIATLTVLE 31 15 48%
5786 ALE-27-GLV ALEGLGAIAPELAAREGDLNDGADVPLLLSGLV 46 6 13%
5787 AIL-27-LTL AILAFIALVLLTSLIGLALLLLGGTFAGTILTL 47 4 9%
5788 LLT-26-EAI LLTREGEIDIAKRIEDGINQVQCSVAEYPEAI 35 11 31%
5789 LGG-24-LNA LGGKSPAIVDADADLDVAAERIAWGKFLNA 37 16 43%
5790 GLV-27-VLD GLVHVSEMDWTNKNIHPSKVVNVGDEVEVMVLD 39 19 49%
5791 VLE-28-AIA VLEGGGAEEADGAELALAILLSFLLGLDKALAIA 48 7 15%
5792 IAG-27-LGY IAGFPGAFISMFFTGSLLIEVIFSLNGLGLLGY 31 11 35%
5793 VIG-29-VAI VIGAVLIPGAAAPKLVTRSMLADMLPGAVLVDVAI 38 11 29%
5794 ELV-26-IGG ELVSCFLILVTDDMNSIGRKENGALQLSGIGG 31 13 42%
5795 ELI-28-ALS ELIEIGKQDLAFAGGGEELDATLALLFDAMGALS 39 7 18%
5796 LVD-28-VLN LVDGSSYLYRAYHAFPPLTNSAGEPTGAMYGVLN 29 12 41%
5797 GEL-28-LLF GELDTQPLIEQLWRAGKRVYLPVLHPFSPGNLLF 33 11 33%
5798 VAI-26-EAL VAIKAVTINEPFFNGHFPGYPVMPGVLIMEAL 48 11 23%
5799 LGS-29-FLL LGSDSALLVDGSANGAALLGALVQHTFGGAGSFLL 35 6 17%
5800 GKL-26-GLL GKLSLNDASLFYEPESSAALGFGFRCGFLGLL 38 18 47%
5801 VSG-27-LLP VSGRSGSGKSVALAVLEDMGFYCVDNLPVVLLP 35 12 34%
5802 VID-29-LAK VIDDIKTIRRTAETLLKREVCEVVTATDGLDALAK 37 8 22%
5803 YLL-25-IGV YLLHQLIGDTGGALRALERAYVAGKLAAIGV 29 7 24%
5804 GFL-25-IAV GFLWFNTYPAQVFMGDVGSLALGGALGTIAV 35 18 51%
5805 GLF-28-LEA GLFNPKARNDIRTCRILLERYGGEVPEARAALEA 32 16 50%
5806 VLF-25-LLK VLFDNINLQVDERDRIALVGPNGAGKSTLLK 33 16 48%
5807 IVD-26-GVL IVDRKKDMILVSGFNVYPNEIEDVAAEGPGVL 33 11 33%
5808 ELL-29-LLG ELLVAEEEDGDVLRLAGELPAIIVPETLDPINLLG 59 9 15%
5809 GGG-28-GAL GGGILLSVAAGVLRAFAEAKTIPPAGVLAGKGAL 56 13 23%
5810 LGL-29-NLL LGLGFALASAVTGGRLGTGSGYGDAGLAVLLRNLL 49 5 10%
5811 LIA-29-GLG LIAGGHGFGKTHGAGPADAVGPDPEAAPIEGQGLG 62 17 27%
5812 ALG-26-LEL ALGKERTLLEAVVTTLDQENGGLEDVSGLLEL 50 9 18%
5813 LGV-29-LTI LGVQRFDYGLADTENRVGQVTGLAWTEVGGDLLTI 41 23 56%
5814 IAA-27-ELI IAALKAVGMKLLMGLNLIQEPVAAGRAKGAELI 38 12 32%
5815 VIA-24-LSG VIATVVAVRPQRFFDIVAFIGASAALLLSG 46 9 20%
5816 GAG-26-SAL GAGKLTLLSLALGDGAPTSGLLADLGARISAL 56 5 9%
5817 VDL-25-ITA VDLKGAGDLVEVAFNYPAAGADELNFLDITA 28 10 36%
5818 ALL-28-ILD ALLGAGFKALRLGETSATLLVGALGLVADLLILD 48 9 19%
5819 LIA-27-DLA LIARCLRAKTPLVCAGPAGGQIDGTPIQPADLA 48 9 19%
5820 LTL-26-ALN LTLIEPLRKALREPENYDVRGAAMQAATQALN 39 7 18%
5821 LAI-27-VVS LAIEAFLGVGKTLFILDPGIALLREFPKSLVVS 37 6 16%
5822 IVG-27-VLL IVGGVAAVLALITVGVLIALESAPASLALLVLL 44 12 27%
5823 IGG-29-GAS IGGGIASALLSLALARRGWAVTLYCADEAPALGAS 37 11 30%
5824 DLL-26-GAS DLLIRNECALIAFQAMLDAQARAALDVPDGAS 35 6 17%
5825 AGL-25-DLL AGLFNGGRDLALLGRGVAEALADSRSEIDLL 56 8 14%
5826 IDL-27-VVL IDLSIWQEIDLVLTLMVTSKGIAGVPGVSFVVL 33 12 36%
5827 LDG-26-LIG LDGGEGSNRLEGGAGNDVLKVAYRSADNVLIG 35 12 34%
5828 VLF-26-LLE VLFKSPAGHAGTNGGGPIADAEAIDGANKLLE 38 12 32%
5829 LGI-24-VLS LGIGAVGLAGIFILGGVLAALYAGLAVVLS 46 6 13%
5830 ALG-27-IGG ALGGAIGTGLFYGSADAIGMAGPSVLLAYIIGG 58 18 31%
5831 ALE-24-LVS ALESAVVDDRQADAVADTLTLSGGESFLVS 43 6 14%
5832 DLL-29-GVV DLLDTAGALFQKERGGAAAVVEAADAALREGLGVV 44 10 23%
5833 VLS-28-LGG VLSGISGGFDSGVSSLMAIGRGCRVHYCLFNLGG 52 11 21%
5834 LEL-29-VAI LELKDISRSYPAGDEQVSVLKGISLKIYAGEMVAI 35 11 31%
5835 SLG-29-LLT SLGGLFANFLVDWVSVATRQAASGGGARHMRELLT 43 7 16%
5836 IAG-24-LGL IAGFPAGFISIFFTGSLLIEVIFSLIGLGL 62 14 23%
5837 KLA-25-LVL KLAAGWLIDQCGLKGFQIGGAAVHRQQALVL 46 16 35%
5838 DVL-25-LAL DVLVARERGPGLATSALGIVLGALVAGGLAL 59 8 14%
5839 EIL-29-IAG EILKGIDLEILSGELLVLIGPNGSGKSTLLATIAG 33 12 36%
5840 DIL-25-FGL DILVSTTVIEVGVDVPNANTMIIEDADRFGL 29 23 79%
5841 IGV-27-VVL IGVVGLITPWNFPLLMAAWKLAPALAAGCTVVL 40 22 55%
5842 NAL-26-GVV NALLQAKEFSKITPLTGIILTKIDGTAKGGVV 34 10 29%
5843 GAS-27-LVF GASIITFHPEASEHVDRTLQLIKEAGCKAGLVF 28 9 32%
5844 IAD-29-VLI IADEPTTALDVTIQAQILELLLELQQKEDMALVLI 31 17 55%
5845 LGY-29-PLL LGYKQHTRTDAEGYIEKLHITPANAHECKHLSPLL 32 16 50%
5847 LLI-27-LIV LLILDEPTNHLDIETLSLLEAGLTLYAGAALIV 49 10 20%
5848 VLG-28-GLI VLGGAGLFAAFPLAYAVDTAALYGPLILGLIGLI 48 10 21%
5849 GSL-29-AIL GSLSIAVQAYMTAKVAFIVPRTVFVPAPNVDSAIL 43 9 21%
5850 SGG-28-LDG SGGREHAIAKKLLASKDVDKVAVAPGNDGLDLDG 33 8 24%
5851 GVI-28-LGA GVIGVMILFAARIKRSFFQVVDFIAPLIPFLLGA 48 8 17%
5852 DLV-24-LAL DLVIVAAAIEADLLAFAGKPMGRTLTGLAL 52 8 15%
5853 LGS-27-VVI LGSARFPEFGDENIRAVAIENLKKRGIDALVVI 31 15 48%
5854 IDL-26-LAK IDLNLPLAANLRNVAAALGKPLSSLTVQILAK 36 10 28%
5855 VVS-25-GSL VVSHRSGETEDATIADIAVATNAGQIKTGSL 35 14 40%
5856 LGY-29-AAL LGYYALAGNLRKAAQLVALPHGGKFPEAAAALAAL 47 9 19%
5857 LLS-25-DLL LLSSLLDSALAALLLVVALGMSEAEKIVDLL 56 10 18%
5858 LVE-25-DVI LVEDLVNRSIEPLKVALKDAGLSVSDIDDVI 36 21 58%
5860 AEI-25-VLI AEIVETAKRTGAQVRGPIPLPTRKERFTVLI 33 13 39%
5861 GID-24-SLA GIDGLTRGELIAAFKSVEEILKFIGADSLA 34 14 41%
5862 ELL-24-LNA ELLSALLKASGSYLSRLGKDGRRALRALNA 40 9 23%
5863 GLG-26-LFG GLGIVYILHLRNMIELVGGLLVLPLLAQALFG 45 25 56%
5864 AGL-27-LGY AGLSMGVSELAKGIFGVFLEAVPGDFLLLNLGY 39 6 15%
5865 VIG-29-VAL VIGSVAGGLTILLLARRAALQALLASPLVLASVAL 53 9 17%
5866 ELV-27-EAL ELVKQLASRGDRIPLDMVANATSTQHAPLREAL 51 6 12%
5867 PLL-24-GLI PLLEALSEADLVLRQGVQGITDLITQPGLI 43 8 19%
5868 ILV-25-LIV ILVVASKDGPMPQTLEHILLSVQVGVKHLIV 40 10 25%
5869 AKL-26-LAE AKLLAAAKTPGLALGVGVGRGGLTAILALLAE 50 4 8%
5870 VLN-25-IGS VLNAGRIEQVGTPLELYNKPANLFVAGFIGS 26 21 81%
5871 LLD-25-VVI LLDEPTNDLDIDTLGWLENALELFPGCAVVI 39 16 41%
5872 GLI-25-LIE GLIIALEIMDLLILIIRSWRAKEKAAETLIE 41 7 17%
5873 GLI-25-GAI GLIAVIEGEPSHKGVRTAIHALAALLHVGAI 43 7 16%
5874 EVL-27-LLP EVLHGNFIRTARAKGLPVRRVIARHALAAALLP 39 11 28%
5875 KLA-29-LLE KLAKELSKRSTGRTLYILDEPTTGLHFHDIAKLLE 45 16 36%
5876 KLA-29-IVD KLAEEDPSFRVETDEETGQTIISGMGELHLDIIVD 29 21 72%
5877 GVI-27-NLL GVIGFLRLTLKTGLKPGQVDRLGAIKSTLNNLL 37 22 59%
5878 LAT-29-LAI LATQTLKQGRAKTMKIEVDGKLAPGVTAKDIVLAI 48 24 50%
5879 EGL-26-ELA EGLYYYDVVYVKGKPRHFMFVTNFEGDPYELA 48 17 35%
5880 GIS-27-GGG GISYKAAWDAINEMNQLSEHRLVERATGGKGGG 33 11 33%
5881 VFL-28-RLI VFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLI 26 11 42%
5882 LGY-25-LLT LGYAVAENLRMHFTGDLDKRAVRYLLAYLLT 33 4 12%
5883 LAA-24-IVL LAALLAGLALGLLLLLLAVGALAALLLIVL 59 6 10%
5884 LEL-27-LLG LELRDLSKKFGAGKAVLDASLNINKGEVIALLG 52 10 19%
5885 GGG-29-IAG GGGICHNEEELKEIVENGLKLSPVTQCLIEKSIAG 42 27 64%
5886 EIA-24-ILG EIARGLQNYYIYTAKGRIVAVSSPGTAILG 38 7 18%
5887 ELG-28-LDG ELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDG 37 18 49%
5888 IVG-26-GVG IVGQEAGIKALKAALAAPSMPHLIIAGPPGVG 38 11 29%
5889 IGG-28-LLK IGGASFIDFQQDLLNLSKRAWLARGPISVGGLLK 35 7 20%
5890 LGS-27-ALG LGSGGALALTGPSILLSYMIGGHVIFFLMRALG 55 18 33%
5891 GIT-25-GAG GITQHKHGVATIQEIVNLLLLRGNIGRPGAG 35 18 51%
5892 VGK-27-LDV VGKTAVVEGLAQKIVDGDVPQKLQGKEVIRLDV 31 23 74%
5893 LGY-27-SLA LGYGANTLRVTLGTSGYVPMIDELRTESDVSLA 32 7 22%
5894 LLL-24-ELG LLLDEPLSALDAKLREELRAELRRLQKELG 55 16 29%
5895 LLV-28-TGL LLVAAALIALVELGLAPAWVVIIIIAREFAVTGL 54 14 26%
5896 ILA-26-VIA ILAKGGGEELYKKLNSAVFPGAQGGPLMHVIA 45 11 24%
5897 GLG-24-GGG GLGRPGGSFAVGSEDVIPDAYRLGKALGGG 63 25 40%
5898 ALK-24-GLD ALKASGKTVKILTGDSELNLAKVLHETGLD 39 10 26%
5899 AVL-27-LDL AVLLAALATDVTGAKVRAKLALVALAALAHLDL 50 13 26%
5900 GLI-28-LVL GLILGLGGGLPGLLLIALVDGYLTLILAVPALVL 57 6 11%
5901 LVA-25-LIE LVARALHRHSPRAKAPFIALNMAAIPKDLIE 39 22 56%
5902 GVL-25-GLS GVLAAALGVLLVGGPGAAILTVGLPVLLGLS 48 3 6%
5903 DAL-24-VLS DALLAKSIWLIGGSGAHLLGADGGLRDVLS 46 12 26%
5904 TLA-25-GFL TLAVTALKRGAIKRIILTRPLVAAGESLGFL 38 8 21%
5905 LLP-27-VSL LLPVDLLRIPIFSLSSQTSLIYFEADDLAMVSL 47 13 28%
5906 GVI-25-IGA GVIGSKPPHLLGEEIRKKPPEIKDMFIDIGA 43 15 35%
5907 EGL-27-LAE EGLYYYDVVYVKGKPRHFMFVTNFEGDPYELAE 49 17 35%
5908 DIL-24-DVL DILLGGDGDDVLDGGEGSNRLEGGAGNDVL 32 18 56%
5909 VIV-28-ALL VIVEPVAGEGGVVPAIPGFLQGLRELTDRHGALL 55 21 38%
5910 TLG-24-VLG TLGGTGKEKGKRHPTLGDNVLIGAGAKVLG 43 26 60%
5911 DAI-28-GKL DAIMKARGTLEGARELDKGPKKVIFGGRDLFGKL 36 7 19%
5912 EIV-26-DAL EIVAHERKDLSPEGQKRVELEAHLLMSLMDAL 36 5 14%
5913 LIA-26-FLL LIAVAAAEVGALALAALGLLELLLLAAIAFLL 44 2 5%
5915 GLI-27-IAA GLILTNDEAIAKKINSAAFPGLQGGPLEHVIAA 52 13 25%
5916 ASL-26-GVL ASLLTLLDDVAALVDDVAENAKLAALGGAGVL 56 7 13%
5917 VVL-25-LGT VVLGGIARLAGFSIFKFLRYIKEELLIVLGT 38 14 37%
5918 GLV-27-AIG GLVLLLFAVAAAMGTMIFTVGGATLEFIKVAIG 47 7 15%
5919 GLV-29-IAD GLVRKKEAADAVVGMLEETLWLLAVAAAYLLSIAD 36 6 17%
5920 LIE-24-LVD LIEGARDGDGPGIPFLVVCHDILGLTALVD 37 12 32%
5921 LSV-28-TGL LSVYDNGDGFARLFGHDKFEPFFRTKELLKGTGL 35 23 66%
5922 LIV-29-LGI LIVGDFIHYAKTNGIPVGPGRGSGAGSLVAYGLGI 44 20 45%
5923 LLP-26-ISA LLPDAEGSVRAERRAGDEVRKILQDEGLMISA 35 6 17%
5924 TLI-26-VGL TLIEESGIKTAQAAEATAEVLLAFLLFLEVGL 42 11 26%
5925 ITL-25-ASL ITLGGRQAFRFLPVAGVIEVTLADAAQLASL 36 8 22%
5926 VIV-24-LVI VIVCNGYKDRDYIRLALIGEKGLHKVYLVI 35 8 23%
5927 IVV-26-LAI IVVGSSDYDAIIYEMDQNDNSLTLATRFDLAI 35 13 37%
5928 GAS-24-AIG GASDMSGWLLMGLPGAVYLSGLSESWIAIG 41 23 56%
5929 IVD-28-GGG IVDLAGALATLGAKISGIGTDRITIEGVERLGGG 31 10 32%
5930 VLA-25-ASG VLAGAAAVADHADAGAALLYNIFRLVALASG 56 6 11%
5932 ALV-27-LTL ALVLCLTRELADQVAGELRRLARALSALKGLTL 60 11 18%
5933 LNA-26-AAL LNALVEVVLLAVRLRAGAEQEAVASIAVAAAL 56 6 11%
5934 LLL-26-GAS LLLVERLSAARRLGHAVLAVVLGLAVLQDGAS 55 10 18%
5935 TLL-28-LAK TLLSCLSRLLKPDSGEILLDGKDIAKLDSKALAK 47 18 38%
5936 DLL-27-LVV DLLPVLEKVAQAGKPLLIIAEDVEGEALATLVV 48 21 44%
5937 ILL-27-GIG ILLRPAEYDVIATLNLNGDYISDALAAQVGGIG 46 17 37%
5938 LDL-27-ALV LDLSAAELERLLALGAYLLGGNGALSLRSRALV 49 6 12%
5939 VVL-29-LSL VVLALLLGSILLLFLAAALPALLAGLLSLVLLLSL 54 6 11%
5940 GAL-24-LVE GALTLALRALVGAEGIAAGAAKHMPGALVE 44 6 14%
5941 VGL-27-ILV VGLGFIPLYAAGLCLIANTAPVAFGAPGIPILV 37 9 24%
5942 IAG-25-IGG IAGMAGATVATSFAPDIAAAAGILPAMVIGG 45 11 24%
5943 LLR-28-LDL LLRGGGEDIVVRSLGIAALLEIGRRAFDLRFLDL 47 11 23%
5944 LAT-27-LLD LATYMVEGGSSKAFTKIKKMMYADPQALHLLLD 47 15 32%
5945 IDL-25-LLR IDLPDETPADAEVKSLGSFALLKCRELALLR 37 6 16%
5946 VSG-24-LPL VSGAIDGAKRASLPIMFGGIALAYEDLLPL 35 13 37%
5947 GGS-25-LLG GGSTNDATPTLAGTAEANSTISIFDGTTLLG 48 22 46%
5948 GGS-26-LIG GGSIGAGLFVALGGTIAQAGAGGAGLSPGLIG 37 18 49%
5949 ALN-28-AAL ALNAAADRLGQRLQALRLFTRDAAHEQRTPLAAL 60 16 27%
5950 IGS-27-GAI IGSSVSTMITAGLAFMGIGTAWGLVAALFAGAI 33 17 52%
5951 SVV-25-LPL SVVANAGCVAIGLVAAACLKPVQIIANPLPL 34 12 35%
5952 VLF-28-GLF VLFTLISATGIRSWILRNIPHGVAHGTGIGIGLF 32 12 38%
5954 LLI-29-GGI LLIALLVLLFFLFAGKKILILLHLAAEIVSIAGGI 44 9 20%
5955 ALK-28-LSG ALKSVNLDIRGGEIVALLGENGAGKSTLLKILSG 46 16 35%
5956 ASL-24-LIE ASLKAKEESYAQAELLLNGENKLGTLNLIE 40 6 15%
5957 IVL-25-VSL IVLDPVNREVISAALPEGKKKFIGGNCDVSL 37 6 16%
5958 VGL-25-FGL VGLAGLLDLGLTLFAAVIAWSYAILLSGFGL 40 4 10%
5959 LID-24-LLD LIDSVSRFIPGVLGHEASALEDSFADGLLD 47 16 34%
5960 LPL-24-LLP LPLVMLGLHLVLTPLHTELINQGGATALLP 53 9 17%
5961 AIV-26-IGG AIVGVSGGGKSTIDIAMTREIDVTGGEIAIGG 37 15 41%
5962 LGS-29-IGL LGSIVIKATLIGLRAGNPLPGVATTPVGMLAFIGL 41 13 32%
5963 ALI-27-IVD ALIVAGFESLVHAGLRYEVAYFETAHERKLIVD 32 20 63%
5964 LAI-25-LLV LAIVFIAIALLLASAGLLSLVLLILALLLLV 64 2 3%
5965 DLI-25-AIG DLIIPGGHKANGISRLLKDILLTGGNIVAIG 32 8 25%
5966 GGI-28-LVI GGILALLFGAIAAAGVNTLITSPVDAVIHRILVI 35 14 40%
5967 GKL-27-LLN GKLSVYTAAGGISPAYTLPVVLDVGTNNEELLN 34 15 44%
5968 NVL-27-LVI NVLLAEAKVPYDIVLEMDEINDDFADTDVVLVI 28 23 82%
5969 LLS-26-ILD LLSLAVLGTAGCGWALLAALQVAATGKVMILD 40 6 15%
5971 ALI-26-VLF ALIACCLTAAFIVAQLLAGGLFELPLIVAVLF 40 7 18%
5972 DLL-25-LVG DLLYRTLEPKFRAVKDAGKSVSEIDHVVLVG 45 18 40%
5973 AVL-25-LLR AVLLGVGLLVALALGLCVLALSGIGALTLLR 61 8 13%
5974 VLS-24-GIG VLSAELHRKGIYPAIDALASLSRLAKFGIG 40 8 20%
5975 GLA-29-ALE GLAVANSLAAIEAGARQVECTINGIGERAGNAALE 64 17 27%
5976 GIA-24-SVV GIAAVTNGLALGAAGEAARAGAEGRGFSVV 37 12 32%
5977 DLI-28-VLL DLIVDSYIKWRISDFSRYYLATGGGDISQAEVLL 37 10 27%
5978 GKL-24-ALN GKLILVTAINPTPAGEGKSTVSIGLADALN 31 12 39%
5979 LDA-27-GLG LDADVISIETSRSHGDLIDAFETTEYGLGIGLG 49 14 29%
5980 TGL-28-IEA TGLNTPKEYSPLAVKELAEVTGADCVPAEDLIEA 34 12 35%
5981 VLN-27-AIL VLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAIL 31 16 52%
5982 LGL-29-GAS LGLMALEKLGEVAILLLQDLALLQIIMAAGLQGAS 53 6 11%
5983 LSA-27-ASL LSACLTAAGAARSLAGLAGAASAAGATSLLASL 59 5 8%
5984 SLA-26-ASG SLAVALALPLAPAAVNVNGGAIALGHPIGASG 49 11 22%
5985 GIL-25-LVF GILIISLLIGLSPAALISGLGAMAAVLVLVF 35 6 17%
5986 GAG-25-LNA GAGVTLRFLLVLLVPVALGITDNATPTYLNA 36 7 19%
5987 GEL-27-GIS GELSRIALAIQVITADKMETPALIFDEVDVGIS 30 18 60%
5988 VGI-27-LGL VGIPAKEVRRLFDPFFQVGTSVQRNFGGTGLGL 47 15 32%
5989 GAS-26-GLA GASISLAAPFAGLFVEILLTGLALVGLYAGLA 51 7 14%
5990 EVL-25-VGK EVLVDDRTERKGIKEQDKDLGGLPAAATVGK 32 17 53%
5991 ALT-26-LTL ALTGAGALALALDGAVSGAGRLPKTGGITLTL 55 12 22%
5992 AIS-27-GVI AISLLVVFLCLAALYESWSIPFSVMLVVPLGVI 35 14 40%
5993 LGF-24-LLL LGFLIAGLGLEILLLDGGRPVRLALLALLL 63 5 8%
5994 LGF-27-IAT LGFGFRCGFLGLLHLEIIQERLEREFDLDLIAT 30 20 67%
5995 EIV-25-AIL EIVGEEHYAVATEVQRVLQRYKELQDIIAIL 31 14 45%
5996 GIT-28-IEA GITESDAGLAAASNAILVGFNVRADAGARKVIEA 31 8 26%
5998 LIA-25-TGL LIARLAQKARAAGIHLILATQRPSVDVITGL 44 25 57%
5999 ALI-24-EVL ALIDAATEVGAGIPLEARTHGLFLDTPEVL 42 6 14%
6000 ALS-26-TGL ALSGGVDARLAAALALAAILDALFLDEPDTGL 47 13 28%
6001 GLG-28-EVL GLGLTAFPLIDFDGPHNLMMQRFTSQGIEFPEVL 42 17 40%
6002 LSA-25-LIE LSAEILKLLAKAIPGAFDEIDLTDIIEMLIE 44 6 14%
6003 AAI-27-IAS AAIAAAGAPLFLLTPSPASFALALAGAVGLIAS 42 9 21%
6004 SGL-25-LAE SGLTYMAARLKNFGVAGSLHLVEVDRSVLAE 55 7 13%
6005 GVI-26-LIG GVISGGIGTAAGGLLATALNLLMKLIAGLLIG 40 12 30%
6006 GVG-29-LSA GVGVTSALGGLMLLNLAAVALSILHGGITLSGLSA 47 11 23%
6007 TLG-28-GLA TLGAAVIYIVSTNVIAGIVPNMDLANSTAPFGLA 49 10 20%
6008 LIA-26-GLI LIARLAQKARAAGIHLILATQRPSVDVITGLI 57 25 44%
6009 LIG-26-AIL LIGGVAAGFLEALLLGLQTSAVAILVLLGAIL 55 12 22%
6010 GLS-25-IAG GLSLGAATGIALGLARDLGTSIAHAILPIAG 46 6 13%
6011 VIA-28-ELI VIARAIAVEPEVLLLDEPTSALDPISTLDIEELI 35 9 26%
6012 LIE-27-EAL LIEELQREERTAIEELVATLSLIELASGTEEAL 46 6 13%
6013 LSV-24-LAT LSVAGVDYLQAHGLGTALALPATACGLLAT 41 13 32%
6014 LTG-29-VLA LTGKLGVCFGDAGPGALHLLNGLLTARLDGAPVLA 60 14 23%
6015 EIL-25-LLR EILEDIDLRIPAGSFIILLGPSGAGKTTLLR 40 14 35%
6016 VIL-27-LLG VILPLGIISFIDLLLNLIAAAILRTKVKLILLG 57 13 23%
6017 AIG-25-ELV AIGLVIPELNGKLDGAAQRVPVPTGSVTELV 39 22 56%
6018 EAI-28-EGL EAIAKGKPGLTEAGGASLIFRGAITGIGTSDEGL 32 7 22%
6019 ELG-29-EVL ELGAALLLRGSAILQVEKDLAIMLIERGAAIPEVL 42 8 19%
6020 IGG-29-GFL IGGGSIRIHRRDVQEKVFAALGISAEEAREKFGFL 37 19 51%
6021 VAI-28-VAL VAIGFNAHGLGADTLFPDALLLAAAISIGLKVAL 50 9 18%
6022 GGI-28-IAG GGICHNEEELHEIVTNGLKLSPVTQCLIEKSIAG 40 19 48%
6023 EGL-29-LSV EGLKAVAAGMNPMDLKRGIDKAVIAAVEELKALSV 35 12 34%
6024 GAS-27-AIL GASTLRILRRHILPNILAPLVVEATLAAAGAIL 37 15 41%
6025 DAI-26-LAK DAITGADQAEAVALYKRQASLKSDLLRTDLAK 37 8 22%
6026 FGL-24-LSG FGLIVLPTAQAFAPGVSRAADLENALLLSG 49 2 4%
6027 TIA-28-LVA TIAARVAQFGLPAAETVETLGVPATAGLVACLVA 42 13 31%
6028 GFL-29-ELA GFLSGKRILITGVASKLSIAYGIALAMHREGAELA 32 13 41%
6029 NLA-25-LGV NLAVALAFAGAGVGLLDADIHGPSIPKMLGV 36 12 33%
6030 VFL-25-IGG VFLIEEPMAAAIGAGLPVSEATGSMVVDIGG 32 21 66%
6031 LLA-24-VEL LLARALVSKYAEHLPLYRQSEIYARQGVEL 61 18 30%
6032 ILL-25-IGL ILLALSFLILGALLALFLAGALLIIASLIGL 56 3 5%
6033 LAI-27-AVL LAIFALFAAAFFLKAGALALFKAYGLGVVVAVL 62 7 11%
6035 LLS-29-AFL LLSDGGVHSHIDHLMALLELAAKRGAEKVYLHAFL 47 21 45%
6036 EAL-27-IGS EALLAVADKTASLIITGNGDVIQPENDLIAIGS 36 23 64%
6037 GLI-26-LLT GLIALIIFRDLGGLKILMVLITNGCPLAILLT 44 10 23%
6038 GAL-28-ILL GALAAGRRLMDTLGVIIIAEATSIGGGLVRDILL 51 9 18%
6039 GIG-26-EGL GIGPRYCPSIEDKVVRFADKNSHQIFLEPEGL 34 21 62%
6040 LSV-26-LTI LSVTLLGELEKWFLLIKTITVIMFMAVGKLTI 31 13 42%
6041 VLD-27-SGG VLDEIVEKSLRGAALWDEVKDRLHKSALGLSGG 44 23 52%
6042 ADL-24-ILV ADLVLAIALAVYGAILGEGQGCIAASRILV 31 6 19%
6043 LDA-28-LGV LDADVISIETSRSHGDLIDSFERANYDLGIGLGV 53 14 26%
6044 DIL-28-LLS DILTFSKMWAVFHALTYETFELGQSLWFVVSLLS 40 8 20%
6045 VSG-27-VFL VSGTHAHALVQTYGALYIAFKKYAESHKDCVFL 27 13 48%
6046 IVV-27-LLV IVVNELVADTGRGNFGLKCVADAAIIFAVLLLV 39 6 15%
6047 VLL-28-GLF VLLGAAPHIAWPMRFRLPHPPHLRPAWRIRLGLF 45 16 36%
6048 ILL-27-GIT ILLLDEPTSALDPALREAILDLLRQLNAELGIT 39 25 64%
6049 LLT-27-ALN LLTLLLDGPKALKAPENYDERAANMQAATQALN 36 8 22%
6050 AGL-24-TLI AGLVGVMVVLDEPGIGLHQRDNERLLGTLI 42 9 21%
6051 LGA-28-GLF LGAFLAGVLLADSLYRHELERDIEPFKGLLLGLF 44 13 30%
6052 GLA-28-DIL GLAIDPSAKPLDLSVGAQQRVAIATPLLMGADIL 38 10 26%
6053 ILG-28-VLI ILGEERVVVVDMPGTTRDAIYIPMERDGREYVLI 39 13 33%
6054 GAG-28-ASG GAGGLGLSGALALGEGGGGVTVLEGARVGAGASG 59 19 32%
6055 TGL-28-LLI TGLAAVTIAIALGLAGLEVPVALATYLINIALLI 48 7 15%
6056 IGV-26-GLG IGVLLLSVAGLFELFGQLDLILEVPEGATGLG 43 6 14%
6057 VSV-25-ALA VSVPTAASSADPAEHLAVGALRAGERWLALA 60 14 23%
6058 VIE-24-ILA VIEAVVENLEIKQEVFAQLDAICKPDAILA 32 17 53%
6059 VIA-27-LGV VIAKIEKPEAVEGFAEIVAAFDAIMVARGDLGV 48 16 33%
6060 IGG-29-LLS IGGVLLGIILDWLMRRGGSLNIARKLPGVLGMLLS 42 10 24%
6061 DLA-28-AIT DLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAIT 31 12 39%
6062 IDL-25-ILA IDLEMTGLDPERDRIIEIATLLTDAELNILA 34 12 35%
6063 ILD-25-LLG ILDVTGDTATLGKTQGKDQELGKSTYPALLG 38 27 71%
6064 TLG-24-LGI TLGSLRPDKRRRIARETLEIYSPLAHRLGI 42 14 33%
6065 FGL-26-VVL FGLFGPGIVLVYLSIAFFAGMPGVGVAALVVL 37 5 14%
6066 SLL-27-LTG SLLVTSADRPDVLVAACLAAMNGVEIGALLLTG 50 13 26%
6067 ALI-24-DLI ALIHGPELLLLDEPLGGADALTRALAQDLI 36 11 31%
6068 LAK-28-IVA LAKKAVSPSKNSRGEETGEAIGLLVEALFALIVA 41 6 15%
6069 AVL-25-LLF AVLVGGTAGGPTGKEIFELPFVLVETFLLLF 47 12 26%
6070 LAE-28-LVD LAEEDPTFRVETDVETGQTVIAGMGELHLDVLVD 52 25 48%
6071 IGL-24-EAI IGLTPTVLALIVEALEQALAVLGESVVEAI 44 6 14%
6072 LVG-25-RLI LVGANISPLLWKKAKGGLSAGRVQSVALRLI 39 10 26%
6073 LVG-28-LDI LVGFSGSNLRIPGFLQPWEEDFGKPERIVGALDI 34 11 32%
6074 LVA-27-IGS LVAWGTSAPELVVFAFAAGLLAFALALGNVIGS 40 15 38%
6075 GVL-24-VSL GVLSAGAAPAAFLAALIFAGTLVALRVVSL 48 3 6%
6076 SLG-27-LSV SLGAVAASALVALLAELLLLASDAVFRIETLSV 40 6 15%
6077 ELV-28-LLV ELVEEFNGPIEKTVKTLLVKASEIENLLDVALLV 48 8 17%
6078 LVD-24-AGI LVDELAHTNVGGSRSDKRWQDVEELLAAGI 37 15 41%
6079 GIS-24-VLV GISFPAGSGLVAFAAATGVMPLDMPESVLV 35 23 66%
6080 VID-25-IAG VIDTAHGHSAGVLRKIAEIRAHFPNRTLIAG 32 14 44%
6081 IAD-27-AEI IADFLTRIRNANMVKHEKLEVPASKIKKEIAEI 33 22 67%
6082 LDG-29-AVL LDGKNARLLGCALWITKELPSSAEIILRAALAAVL 50 11 22%
6083 VGK-29-GDL VGKSGHIARKLAATLASTGTPAFFVHPTEAMHGDL 27 12 44%
6084 VLL-27-ILG VLLGSIGGFILGFPGAGKLGLAGGPLIDAAILG 50 7 14%
6085 LLD-26-IAV LLDIIFSADDVATAVGLSDHIFIMMAAVVIAV 38 7 18%
6086 DLL-28-ATL DLLGGLRVLTLPTDVAASLRIVIALKRESLLATL 46 6 13%
6087 LGV-29-AIE LGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIE 36 16 44%
6088 LVV-28-ASL LVVFGRAAGLHLGESLAEQGAGRDASLADLEASL 55 9 16%
6089 DAL-27-LVG DALRGLLNKLTGKQVHINIIEIKQPDLDAHLVG 45 9 20%
6090 ELV-25-LDL ELVIRTKDSVKVLDYDGNVLERASYTAELDL 39 9 23%
6091 ASG-27-SLG ASGAAISQAGPGGALLSYGLIGLMVYFLMTSLG 43 14 33%
6092 GEI-29-LIA GEIVLNMMNQDGVRNGYDLEQLKKVRAVCRVPLIA 37 18 49%
6094 LDG-25-EVL LDGTLVDSLPAVERAWFEWADRSALTPEEVL 37 7 19%
6095 GFL-25-FLL GFLTDLDPDNAQQQLADVLEGHYISEKRFLL 37 17 46%
6096 ALE-28-IVD ALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVD 33 23 70%
6097 LVV-25-LLV LVVNVLDIFDFNGSIIPGLPRFVSGGAVLLV 60 12 20%
6098 GGG-29-LLG GGGPGGIGFGLDLAGGDAVHQVGAEATHIKCGLLG 58 9 16%
6099 LID-25-FLL LIDEVHMLSRHSFNALLKTLEEPPEHVKFLL 30 18 60%
6100 IEA-26-AIT IEAAGAMYLPTYFIICASLLPEAGEMLIQAIT 29 14 48%
6101 IDL-25-ISA IDLPDADPAEVKAKIEAEIGIDASDAYLISA 32 16 50%
6102 AEI-26-LGV AEISAEVDPGLFLHGASDAHNEAGVNRISLGV 34 10 29%
6103 NVL-29-ADL NVLCFPFIFRGALDVRATTINEEMKVAAVEAIADL 30 13 43%
6105 VLG-28-VLV VLGGRAMEIVEDEADLEGYMTRAVKVSPEHPVLV 55 19 35%
6106 GGG-25-AIS GGGKGGIACDPRDMSFRELERLSRGYVRAIS 34 13 38%
6107 ELI-28-DIL ELIPKERLLKVFEGEAVTKGEGSDDGEINPVDIL 33 14 42%
6108 IAS-29-LFG IASALAYLSAGAAGLAIALNCLALELLLLIGTLFG 34 5 15%
6109 GGI-27-ELI GGIASVFDMKAVLLAGADKVSLNLAAVLRPELI 29 13 45%
6110 VID-29-ELV VIDSRLVGEGSQVRRRRQCLVCNERFTTFETAELV 34 13 38%
6111 EIV-27-PLL EIVSGASRGIRLLQEEEEGLPLLGRVAAGEPLL 29 7 24%
6112 LLG-25-VVI LLGSPLRQDEALMVTQVISTALLPYIAQVVI 46 7 15%
6113 EAL-28-NLL EALGSTSKSLVKLIKEGRIGINTHGLGPQVGNLL 40 7 18%
6114 LGI-29-RLL LGISLLLTLRANALSGGERQLVLIARALLEAPRLL 45 10 22%
6115 TLL-28-LDA TLLDAKAQRTIADELFKDKSPETIKEFLAKNLDA 47 12 26%
6116 AIA-26-IAD AIAFALAVLFCLLIVWGPLMAAIEKRLKEIAD 45 8 18%
6117 LTL-28-GKL LTLGLAFLLAIMETIYVLTGKQIYKDMTKFWGKL 37 18 49%
6119 LVA-28-VSL LVAIDRVLKAKAGHVRILVQGALGLKAAETLVSL 49 10 20%
6120 LVA-27-AEI LVAEGTGLITATVFENRLMHPPELSAMGAHAEI 44 7 16%
6121 PLL-27-ALT PLLIPLAIILLGALLLARAAVLDLPLPELLALT 50 2 4%
6122 LVD-25-DLL LVDIIIIVIRLAGGDDAGRKGGPGEDLWDLL 45 16 36%
6123 ASG-29-ELL ASGFYLVLPLAVEVLRKLEAQVREEKGAAGGVELL 44 10 23%
6124 EVI-26-AVL EVIEKGFGTGTFFLEGIGAAYNMAGFAAAAVL 35 10 29%
6125 LTL-28-ASG LTLAAVHTLGIPVDLPTALLLSVVAAVCACGASG 45 21 47%
6126 GIA-24-SGL GIAPEHIPRLFERFYRVDKARSRQTGGSGL 42 12 29%
6127 IAS-26-AGL IASLYAVYHGPAGLKRIAGRIHRLTDILAAGL 50 10 20%
6128 GVG-29-VGK GVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGK 30 21 70%
6129 IDL-29-IVA IDLGTTNSCVAVMEGGKAKVIENSEGGRTTPSIVA 34 19 56%
6130 RIL-28-VLN RILLEKHNGEVPEDRAALEALPGVGRKTANVVLN 27 17 63%
6131 SLA-26-IAL SLAEAVLAHKSIIALLAAGLGAAELTFSLIAL 60 4 7%
6132 GLL-24-LGY GLLKPTGGQALVLGGDLILGSGAALAALGY 40 12 30%
6133 IGL-26-LTG IGLAAFAVQGALLAALLSQPGSAEIVAAVLTG 45 9 20%
6134 LGG-29-DIL LGGEASAIALDHSVDFGLIAECDRAGEWDGDVDIL 32 6 19%
6135 LEL-27-GIT LELVDMVEKLDLYITVKGGGISGQAGAIRHGIT 33 19 58%
6136 IAG-26-VLG IAGIILAALLTSLALALALGGELIVIGAPVLG 55 5 9%
6137 IAG-26-IAG IAGDGGAALGNTVMKGNARKVRRLGKAFLIAG 48 8 17%
6138 PLL-26-GEL PLLHGLLDANQDARVIAAGLGEYAAINESGEL 38 8 21%
6139 ILV-25-LGT ILVFLVMYLFLQNFRATLIPTIAVPVVLLGT 32 15 47%
6140 GAI-29-LVG GAIGIRLAKKVEATEMPELVAILHSFVGLAAVLVG 45 10 22%
6141 LGS-28-AGL LGSNSFHMLVVREAAGSIQTLAEIKRKVRLAAGL 49 11 22%
6142 LGS-26-GSL LGSLLAGTDESPGELEIFQGRQFKVYRGMGSL 43 17 40%
6143 VIV-26-GVV VIVTTPSDLGLFDAKGGVSMFLKENFLVLGVV 36 10 28%
6144 FLA-25-ASG FLALGVQAWDAAIFHLMTHAFFKALLFLASG 34 9 26%
6145 IAT-26-LTG IATGFGRTGKLFACEHAGITPDILCLGKALTG 37 23 62%
6146 LTL-29-GIA LTLAAAIAGGCEFIVVPEVEAARELLAAEIKAGIA 44 10 23%
6147 GLG-27-GIG GLGARGAGLIGASNIGGGLGLFADTGGIGIGIG 61 2 3%
6148 LVV-24-SLV LVVILGVSLLEGIWLRVGKLPVALIGRSLV 41 4 10%
6149 VIG-27-IGL VIGLGALGLSGVLAAAAPAGLLGFGVLGFIIGL 44 1 2%
6150 TLA-29-SLG TLALLILTIARILELLRSDIELVPYGLALAARSLG 45 9 20%
6151 IVA-24-IAD IVAGVGVPQLTAIMDVAEAAKKTGIPVIAD 34 26 76%
6152 ALT-26-LLI ALTGTLLAEAILPLSLGGLILLAGFGLGALLI 51 6 12%
6153 IGV-26-IAV IGVMAGIASGTLPPLTLIHDKKSVKSLLAIAV 34 6 18%
6154 VVI-26-VVL VVIFSAGTGNPFFTTDSAACLRGIEIEADVVL 38 20 53%
6155 FGL-29-VLT FGLIFYFMILRPQAKREKEDKKLMDSIAKGDEVLT 34 9 26%
6156 LTI-26-SAI LTIAGSDSGGGAGIQADLKTFAALGVHGASAI 28 14 50%
6157 FLG-28-LEA FLGKQDDVNGFLQLSDLNLLLSEKESFGLVLLEA 30 14 47%
6158 YGL-24-LIV YGLGANATNEEAVKKIFEAKGRPSDNPLIV 31 25 81%
6159 LGL-26-VEL LGLSLPGNGSLLATHADRKQLFLRAGKRIVEL 53 18 34%
6160 LIA-25-AFL LIAAVPYKIHTILTDNGIQFTHRKTDRHAFL 45 12 27%
6161 EVL-27-GGG EVLLDGGKAAVAAVLGGAAFEAGGGGAGGFGGG 41 9 22%
6162 ILG-27-ATL ILGYVVRWVDQGVGCSKVPDIHNVALMEDRATL 44 16 36%
6163 VLE-24-LAK VLENIIEGPVIVKGEPKQEARARARELLAK 39 14 36%
6164 TLA-27-SLV TLAWLFCLRLGVLLSLDLSIPVLKHLRRAGSLV 48 8 17%
6165 LLR-28-DLA LLRVLQEREVQRVGSNRPISVDVRLIAATHRDLA 52 22 42%
6166 GSL-27-LLV GSLGLPDLGINTLDDVLTDIRRITDVCDLPLLV 49 13 27%
6167 GSL-24-LGG GSLVATAIALLLAASLVAAGAWRILFLLGG 47 4 9%
6168 EAI-25-GSG EAIINSMTKKERQNPDIINGSRKKRIAKGSG 35 25 71%
6169 GVG-24-LLP GVGKTMLARALARSIGPEFFRIQFTPDLLP 38 16 42%
6170 SGI-25-GIL SGILEVVGGLLGLLSYNPISALLKGNYIGIL 41 10 24%
6171 GDL-25-VVI GDLGVEIGDEELIFAQKKMIEKCLRANKVVI 29 20 69%
6172 IPL-27-SAL IPLPIDLYIATRDNSAGLDLANEHRLASLSSAL 37 8 22%
6173 SVV-25-GGG SVVFDVVIYLRAALRNGTHAVKNRSAVSGGG 33 10 30%
6174 LAK-27-EAL LAKKLASGLFPLLQDGPLEHVDAATAVALEEAL 60 16 27%
6177 LSL-29-IAA LSLALRLAELVKVILLSKGPVSEGALFYAVGGIAA 58 9 16%
6178 LVL-27-LVE LVLVDSLNDVLALLESLSLVDVDALSDVDVLVE 49 16 33%
6179 GLI-27-LVA GLIMIGLARCIAMVIVWNDLACGDAEAAAGLVA 53 14 26%
6180 GLI-25-VID GLIEGASQGVGLGHQFLRHIERTRVILHVID 32 21 66%
6181 GLA-29-GAI GLATLVARRKFDAAEREGGKAALVLGLVGITEGAI 55 23 42%
6182 VIA-25-ILL VIADLGAHKLASASLLSSISEHLPAAISILL 50 14 28%
6183 AGI-24-LVA AGILLVATFGILHHTDATGLLAAREDGLVA 63 7 11%
6184 AAI-29-EIA AAIEGIAAEIAEESALAALIAASVLAKTDAEREIA 44 5 11%
6185 VLI-29-VVS VLIVGGGGGLILDLVSFNDEVEAIAIVAIDAGVVS 36 13 36%
6186 TLA-25-IAD TLAAIKMAKDAGYTAVISHRSGETEDATIAD 37 15 41%
6187 ELV-24-LGF ELVEGTAAAVLGHALGSVHGPYKVEPNLGF 30 7 23%
6188 IVA-25-LDG IVATQGLGAMIENSAPTRAEASDVANAVLDG 32 7 22%
6189 IVG-24-VIV IVGIRRNATALTAAALLLGALIGAGGGVIV 36 6 17%
6191 AEI-26-EIV AEIVLAARNRLPIGGVVVIHRIGEAVPGDEIV 33 6 18%
6192 VDL-27-ILG VDLTVELKKETTYEEICAAMKEASEGELKGILG 33 20 61%
6193 VGI-26-LAA VGIGGGVVKLAFLVKQAEDIALVLAKAELLAA 54 6 11%
6194 ALN-28-KLA ALNASKEILDKAVCLSQLSSQRHIDAKGAIKKLA 36 11 31%
6195 VIE-24-AIV VIEATNLTKSPGDRVLIDDLSFSGPKGAIV 36 14 39%
6196 LGT-29-LPL LGTSHPAKAKASVELILGETLAAPFALAERADLPL 48 9 19%
6197 ITA-26-GAL ITAGVIPLSMLFTATAMVNAGVSGLAMSLGAL 39 8 21%
6198 VGK-25-VAL VGKTAIVLGLGQRIARGEVKELLVSKAIVAL 32 15 47%
6199 LLG-26-ILV LLGTGVGALLGALGLALLAGLKIGGLLLAILV 51 8 16%
6200 IAL-25-LLP IALLFAQLGALLFALAAGAGTTAEGALLLLP 52 4 8%
6201 IAL-28-TLG IALVLVALAVLLRLGMPLDEVIGSIVAGAAATLG 44 8 18%
6202 EVL-28-RLL EVLSRALNTLLIPGLLAKVAAAEADLVRGGLRLL 50 2 4%
6203 ILG-25-VGI ILGLKPTVIFADQIMYTGFAYAARSAASVGI 37 10 27%
6204 LIE-25-ADL LIERLAREAQEDVIAHLDEDVAVAGIAAADL 37 3 8%
6205 PLL-29-LLK PLLTRVAGLGRMLAQNIVAWRDENGAFQNRKQLLK 40 14 35%
6206 GEL-29-GSL GELAVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSL 37 21 57%
6207 FLA-29-LGI FLAMLALTIFIPYSRMGIACRACAEDLAMASLLGI 43 7 16%
6208 ASL-26-ATL ASLLKVEERLAQLVALVAFSGNLFEISILATL 51 5 10%
6209 LIV-24-DVL LIVVEKFSVEAPKTKLLAQKLKDMALEDVL 33 9 27%
6210 VGI-29-EVI VGIYRVIMLIGADNLRASSIKDIMKRIGAKGVEVI 30 5 17%
6213 LIA-27-GVL LIAVHGENDPHAGGFAAAKAWAAATGGHRAGVL 62 12 19%
6215 VLA-28-VLS VLAAAAAPLLAERLLAVLGLARGALALVIKAVLS 61 4 7%
6216 AAL-29-IAD AALILTPIVGAMLRALGFSEAAVLPFVFAAGFIAD 57 18 32%
6217 LAE-24-RLI LAEFLFGDEDALVRIDMSEYMEKHSVSRLI 44 18 41%
6218 VAL-26-TGL VALQYNDGFSDNILSFVLNVRTKDGAGHLTGL 52 8 15%
6219 VLV-27-ALT VLVRYGFPGRHIGDASRDLPFALDNAVLGIALT 51 14 27%
6220 GVL-26-LLS GVLLLGAALRVAILLLALLVLALVAGAIILLS 64 5 8%
6221 LVV-24-IGV LVVGLEIGTAKVAKLVGEVLLDAMVNGIGV 37 7 19%
6222 IAG-28-AIE IAGKGIANPIAQILSAAMMLRYSLDADAAADAIE 35 20 57%
6223 IGA-26-GAG IGAGIGEGTMIDMGATLGGRATVGKNVHVGAG 52 15 29%
6224 LLP-24-DLV LLPAYVTSELKTAFQIGFTIFIPFLIIDLV 37 15 41%
6226 NLL-28-SAL NLLQIEPTQGMIPVPSGSKEIGDEDVESVVKSAL 40 8 20%
6227 GVV-26-LIG GVVYSSSVRIGGDRFDEAIINYVRRNYGSLIG 44 20 45%
6228 IAV-28-VIE IAVKLGIGFLGAGKTTLLRHITNLQGPYLIAVIE 30 5 17%
6229 IAD-28-VLF IADEPTTALDVTIQAQILDLIKELQREHGTAVLF 25 16 64%
6230 ITA-27-LGA ITAAGKVPPAKVLVIGAGVAGLAAIGAANSLGA 40 16 40%
6231 NLA-29-LVI NLADDPAIERIATPRMALTAAEYLAFEKDMHVLVI 29 20 69%
6232 VLL-26-VLS VLLLLDAGGGLVIAGAPVRAALAIAVLDGVLS 56 4 7%
6233 LLK-24-GIA LLKVLGRGISLLDAFAAANDVLKGAVQGIA 38 14 37%
6234 GLV-24-SLV GLVSGAVHTTANTIRPALQLIKTAPGSSLV 48 13 27%
6235 RLL-25-LDA RLLKDRIIMLTGPVDDNMANSIIAQLLFLDA 63 16 25%
6236 VLE-27-ITA VLEELEHAKARGAKIYAEVEGYGLSGDAFHITA 30 19 63%
6237 IGA-27-ASG IGALVRNTDLAADPGVRRGYAALSQALLAGASG 40 11 28%
6238 ILV-28-LLI ILVVDVITLGSGLALIKYLTLVSLLGVLALFLLI 44 5 11%
6239 GVI-29-IDL GVIVQFGGQTPLKLAKALEKAGVPILGTSPDSIDL 29 19 66%
6240 GAI-28-PLL GAIWKFPYLAGIGGGGAFILIFIAFTLLIGLPLL 38 12 32%
6241 LDA-27-IAT LDALGLTCLAPDAVVLMHLMLQAVVGVDLVIAT 34 7 21%
6242 TGL-24-GIG TGLSTISSVDTYSTLGLAIIALILILGGIG 36 6 17%
6243 GLD-26-VLE GLDPKSAYILKEAMREHAGAGKTVFFSNHVLE 35 7 20%
6244 VDL-24-LVS VDLPGVGEDAAADVLAFLMAQEGIAKYLVS 34 6 18%
6245 SGI-28-GIG SGIGFAIAGVIGIREVIINGIPTAAKLAVSAGIG 38 20 53%
6246 IAD-27-FGL IADRGIAGIGIDALTLSSTFDLADFEGQKVFGL 28 6 21%
6247 AIT-29-AIE AITGRDLVLAQIRVAAGHHLPGKQIDITFTGHAIE 28 19 68%
6249 GLI-29-IAD GLIKAVEKFDYRKGFKFSTYATWWIRQAITRAIAD 31 14 45%
6250 KLA-24-SAI KLANDKVVDTIANTLTALLISEVGAIASAI 29 3 10%
6251 GSG-26-VDL GSGGIMLPLHAPGKVAEQFGTLATLAPGRVDL 35 9 26%
6252 LTI-25-LLN LTINAAIAYASVIIPIQCEYYALEGISQLLN 37 11 30%
6253 VLN-24-LLR VLNDISLDIPSGQMVALLGPSGSGKSTLLR 31 16 52%
6255 SLG-29-AGI SLGMRQRLGIAGALLAAPKILILDEPTNGLDPAGI 41 13 32%
6256 IVL-28-ALG IVLAVMILPTIAAVLETAFRALPKAAIEGALALG 52 12 23%
6257 LGF-27-LLE LGFLTDLDPDNAEQLLIEVLEGEYQSEERFLLE 37 12 32%
6258 GLF-29-GLG GLFVKELEVALLEGRADIAVHSMKDVPVDFPEGLG 37 14 38%
6259 LAL-27-ILV LALIAGIALLAVIAVALALAGGILILRVVGILV 62 3 5%
6260 LLG-25-IGG LLGPSGAGKTTLLRAIAGLEFPTSGSILIGG 57 17 30%
6261 GLL-24-GFL GLLTIAPASRVLYPITALSVAGAGALLGFL 47 7 15%
6262 DLL-26-ALK DLLAQAENAANPLAEDFDAAKEFDDALYAALK 41 6 15%
6263 AIL-25-LGI AILAGAALSIAGILAQLLTLNLLASPLLLGI 62 10 16%
6264 VGL-28-ELA VGLDEARAALPLDRIAITAEDFRFRTRARYRELA 48 15 31%
6265 VGL-27-NLL VGLGKEIGSSYLAFMWDDFAPAVAIPAENINLL 36 15 42%
6266 SGG-28-IEL SGGMKRRLMIARALMHEPKLLILDEPTAGVDIEL 29 20 69%
6267 IEA-27-FLG IEARDLTKRFGDFVAVDHVNFRIPRGEIFGFLG 28 21 75%
6268 VAI-26-VIG VAINAPAAVVAIRTIHNIALLLNFGGSVMVIG 40 9 23%
6269 GAS-29-VLG GASATLFGSAGSGNFMTRLVALLATLFFIISLVLG 43 8 19%
6270 LDI-24-KLA LDIRRIGAIKKFDEEIGNQTKGKVVKNKLA 32 9 28%
6271 ALA-24-ELI ALATEPEILLLDEPTSALDPTETAEILELI 55 21 38%
6272 PLL-26-GAL PLLTAGLPLLVALFLLLGLSAMGLTFGPMGAL 56 10 18%
6274 EAL-26-KLA EALEAFGLLVREEGIIPALESSHAVAYALKLA 60 16 27%
6275 EAL-29-GIV EALMDEEIETHESEKEVPENSLAELGDALPAFGIV 45 15 33%
6276 GLG-28-DVI GLGAFPGTMRQNLGMAGMHGTYEARMTMHIADVI 31 10 32%
6277 LAK-28-LSA LAKLGAVLAVLKIVAVVESGLKELIFIYEDALSA 43 14 33%
6278 GGG-28-SAL GGGYAQVLPMELINLHATGDAHAITTANAALSAL 52 11 21%
6279 GIG-29-GGI GIGPEFMAQALKVLGAALLKFFIGLGIIAADVGGI 43 13 30%
6280 LTG-25-VVI LTGGTVISEEIGMELEKATLELLGQAKRVVI 37 15 41%
6282 AIG-28-GIA AIGGGIAAALLSGVLVTILPIVVYGIAGLLAGIA 47 12 26%
6283 LVI-28-LEA LVIGAETKSVALAGVDGGTAVLFGDGAGAVVLEA 34 21 62%
6284 NLL-26-LSV NLLNVVRQASANGILALGMTFVILTGGIDLSV 36 16 44%
6285 LAT-26-SVL LATPDGRGAGTPLAEGCSPAHRMDKKGATSVL 41 8 20%
6286 SIA-28-IGA SIASALGRKFVRFSLGGVRDEAEIKGHRRTYIGA 39 18 46%
6287 GID-26-LLL GIDGVPILARSVFITAFGPVALALNLAQMLLL 42 6 14%
6288 VGK-25-VGI VGKSTLFNAITKAGAEAANYPFCTIDPNVGI 27 25 93%
6289 IAL-28-IGS IALLALILGSASLAATPKQIITAPVLASAQSIGS 36 10 28%
6290 ALG-29-IAS ALGYDSIVKVDTIFLAKNRSLIFLGIDEGGNVIAS 48 9 19%
6291 AGL-25-GLD AGLVLFDIATIHANGAFAALGLAVLQLLGLD 54 2 4%
6292 VLG-24-EAL VLGLLLAEAEGFLSGGARAADSEVAMDEAL 58 9 16%
6293 LAE-24-VLI LAEVRDYTRYLLAPHHLEAGFLTAAGKVLI 43 6 14%
6294 LGG-28-GDL LGGHIASFQSSATIYDVCFNHFFRAPNEKDGGDL 41 27 66%
6295 AGI-26-LAE AGIAAANFPFCTIEPNTGVVPMPDPRLDALAE 52 12 23%
6296 LIV-24-NVL LIVIPNDRLLDIVDKNTPMLEAFREADNVL 29 11 38%
6297 VIL-28-VGI VILQVRIMDGLVKPGDKIQLMSNGKTFDVIEVGI 34 8 24%
6298 SGG-29-GIS SGGELSRIALAIQVITARKMETPALIFDEVDVGIS 37 19 51%
6299 IVG-25-GVL IVGGHLLATLDESFDPGIEVLDAWLFAIGVL 44 9 20%
6300 LLF-25-IAS LLFGIIAASGLRMLVEIKVDLSANRNLIIAS 34 10 29%
6301 DLA-25-GLA DLAGFAVGVAEKSQILDGSKVAEGDVLLGLA 53 17 32%
6302 FLA-26-IGG FLALGIIVFFEGSSSDIIALLGVDGIGAGIGG 33 7 21%
6303 GAS-28-AGI GASLISLFARLGGGIFTKAADVGADLVGKVEAGI 39 16 41%
6304 EVI-27-LVD EVIGKYHPHGDSAVYETMVRMAQDFSIRYMLVD 31 8 26%
6305 ILL-29-LVV ILLAPSAGGMINGMMTLSGAWHKLRLDPILRGLVV 47 8 17%
6306 AAL-26-ISG AALVALNAIAGPPLNDTALLALMGELEGRISG 50 12 24%
6307 GLS-28-LPL GLSIVRSIVELHGGTIEAQSNPGGGTTFTITLPL 69 37 54%
6308 IVL-27-LSA IVLDSLLPGLAGASVLLALPLEDVIARVFVLSA 41 8 20%
6309 VGL-26-GLG VGLAGLLVLGYGGFGAIGAYTFALLNHYTGLG 51 11 22%
6310 GGG-24-GVS GGGMRGVYTAGVLDALAALDLAFPYVIGVS 41 10 24%
6311 GIG-26-ALK GIGAGSGCTLGAVAGVLVGQFTAIHEVAEALK 40 7 18%
6312 GSL-28-EAL GSLLLAGKLGEEATDPARAEKLIQIGWETVTEAL 47 7 15%
6313 AKL-25-LGG AKLYSPQSTLHLISRAIGGQNEQAALGKLGG 37 15 41%
6314 SIA-26-VIE SIAVLREIGVETGGSNVQFAINPANGRVVVIE 29 14 48%
6315 IVV-26-FLG IVVMNAGRIEQIGSPEELYDRPANAFVAGFLG 29 21 72%
6316 VSV-29-GLL VSVLLIILAKFSLTLFRLAFYALILLLLVLSLGLL 45 4 9%
6317 FLG-25-IGG FLGIIEPGIKGTVLMLLALFLLAIIVFAIGG 36 14 39%
6318 SVV-26-GIS SVVAAVSACGASGVAGGSLLLIPLACSLFGIS 28 14 50%
6319 VFL-29-SGG VFLVRKGNPKGIKDWGDLIKPGVSVITPNPKTSGG 29 24 83%
6320 GAL-29-GIA GALIILLGKTGDAAIAKGLIGRSGMIAIGAVAGIA 58 8 14%
6321 LAL-26-ITA LALQRLKEAAEKAKIELSSSQQTEINLPFITA 51 14 27%
6322 AGL-27-AIE AGLFRSRSGIELLFLLAAIFLAIAPEQILLAIE 42 6 14%
6323 LAE-27-ILG LAEGQKDGSLNFDLGIAAPDAMEVSLQIGFILG 43 13 30%
6324 LIE-28-GIV LIEQAEQGVDYFTIHAGVLLRYVPLTAKRVTGIV 33 25 76%
6325 AIV-24-ILL AIVGGTGAGKSTLIGLLVRFYELQIGSILL 54 12 22%
6326 AIG-25-LVG AIGLGLSAVTLLGILLLISIILVILGLSLVG 50 5 10%
6327 LLN-28-GVL LLNALSGGSAGYAEETFNEGKLATVIEVIIEGVL 41 4 10%
6328 LLF-28-LAE LLFLAVDNLLYILDLVLHAAGARVLALRAERLAE 40 8 20%
6329 GVG-24-ALI GVGVIDVLELGVRDIPPPEGDPCAPLQALI 46 12 26%
6330 GGS-25-FLA GGSTITQQLAKNAYLSQDQTIERKAREFFLA 31 16 52%
6331 VSV-25-GIT VSVKASDVFLAVESYRLLAKQIDQPLHLGIT 29 18 62%
6332 EIV-27-DLV EIVLDGLDAFKLHLEELAEYLTAEEDFTPADLV 31 12 39%
6333 VIE-26-VIG VIEAVIKAVIPAEYLDDDTKFFINPTGRFVIG 31 12 39%
6334 GIT-27-GVG GITATGLDETAKGGFREAGADQQTIPFRYIGVG 44 23 52%
6335 FLG-29-LLS FLGLNGLRIPYIISIAGSVAVGKSTTARVLQALLS 42 12 29%
6336 LIG-29-IGG LIGLSTEFLSMLRGYGIMAHTFDQQGPVIPGLIGG 46 10 22%
6337 LAK-29-LID LAKLLMEKPNVLLLDEPTNHLDIDSKEVLENALID 36 21 58%
6338 LGG-27-PLL LGGTDQKFNLLMGRELQKAYGQKPQVVLTMPLL 49 21 43%
6339 EVL-27-LTG EVLEANEGFLNGQVDRLAMPHKMTPVLDENLTG 38 15 39%
6340 VSL-27-VLE VSLPGTLARPSIVSGKTDTGGLLLYLFGGGVLE 39 12 31%
6341 VSL-27-VIG VSLLAGIALTALFTALVLFLLVLAVLLLEKVIG 41 12 29%
6342 ELV-25-LGL ELVWVGRPMVLVVALIAIALAAEPVLEVLGL 46 12 26%
6343 IAS-24-EAL IASIAQIQLERLIARLEEFGAEKLKSDEAL 43 6 14%
6344 IAV-25-IVA IAVYPDLAARSDRALHLGLTEAGMGSKGIVA 40 12 30%
6345 GIS-25-LSG GISGKILPGSFPALDGAASSGFGNLGAVLSG 42 8 19%
6346 SGI-28-ELL SGIEKQILGATLRASFAAHILLEPDDARSAQELL 39 6 15%
6347 LVF-26-LGL LVFADDPTPALFAITAAPFDALTSGIAAILGL 50 10 20%
6348 YGL-28-GIT YGLVVGLDGTGDQTTQTPFTTQTLNNMLSQLGIT 24 9 38%
6349 LLL-28-GVI LLLTRYNPGRVSRGEMLSMEDVLEILRIKLVGVI 59 21 36%
6350 LGL-26-LVE LGLQPYFAIGAAMHIFTEARRLAVLDEIWLVE 56 8 14%
6351 AGI-24-ALN AGINVSSKKIADIIGVIEGIAFQTNILALN 33 9 27%
6352 RLL-25-GIT RLLEITDTLESREMAEQLLDSMDLERERGIT 35 14 40%
6353 AFL-25-GEL AFLSSAVLEFFTSPSIALMAVYFGFSYIGEL 30 11 37%
6354 YLL-25-GVV YLLAGLAIGPWGLGLISDVDEILHFSELGVV 29 15 52%
6355 VLN-28-EGL VLNLTESAEIPTMDTAKATDTVSFQVLNNTMEGL 27 16 59%
6357 VLG-24-ELL VLGHIQRGGLPRAADRTLASRLGARAVELL 61 10 16%
6358 LAE-25-LDV LAEEDPTFRVETNVETGETVIDGMGELHLDV 45 13 29%
6359 LVG-26-IAT LVGGLLYLGLSDIALARRLLVAGGALAVLIAT 38 10 26%
6360 DAL-24-ADL DALRHATASAGARLVKAKLGEYAAGDDADL 52 8 15%
6361 LIV-28-GLG LIVGNCIIVGRAAAFASKNLALIGAFDGILLGLG 42 10 24%
6362 GIA-27-LIG GIAYNREEFEEICTRGLDLSPTKELLIDESLIG 46 18 39%
6363 LTG-27-ILA LTGGIDAGALDLLALGGAAARRLEGSGALVILA 48 6 13%
6364 GEL-26-VGI GELSRISLAIQVITARKMETPALIFDEVDVGI 31 19 61%
6365 VAI-28-GLG VAINAPAAVVPIRTIHNLSLNPNFGGEVLVIGLG 39 10 26%
6366 DIL-27-LNA DILVNNAGIIPRDPMQDMDAEDFRQVIDIDLNA 28 12 43%
6367 ISG-25-VIG ISGLSHGTDVWLGNAQELIKNGICGLSSVIG 34 14 41%
6368 VVI-25-IGL VVIIAFFAGLEGILDAFILLQPLSACTAIGL 37 6 16%
6369 TLG-29-SAL TLGCVRLVYNRALAARTEAWYERKERLDYVQTSAL 41 19 46%
6371 FLG-29-VGI FLGSGKTTLILHLLAHKDPNEKWAFLVNEFGEVGI 30 9 30%
6372 LAS-29-VIG LASHIGGLVLLAAICAFALLLAFLLAGAVAAAVIG 44 6 14%
6373 LEL-27-GIA LELAKTAALADRLVNAGGGGALRKAFAIEEGIA 37 9 24%
6374 ILG-27-LTL ILGGTLLTIFSILLITGGNKIILIIRLVLTLTL 46 6 13%
6375 AGI-24-LSG AGIRPAVNPGISVSRVGGAAQTKIVKKLSG 50 12 24%
6376 VSL-28-VSG VSLVAILDADKEGFLRSGTSLIQTIGRAARNVSG 35 9 26%
6377 LTG-29-LSA LTGIALSALLSRLAAILLVAAVLAIIALVETLLSA 47 3 6%
6378 EIL-25-RLL EILLSILKAVTILSVLVTAGAFESFGERRLL 40 7 18%
6379 VIL-27-LGG VILPLTSGGIVAGCLLVALGALGAFITPALLGG 38 11 29%
6380 VIL-27-VAI VILVVAADDGAMVQAAEAANGRDAAFSALVVAI 35 12 34%
6381 LLP-27-ELL LLPEALAAAREIQDEEYRAYALSSLADKAPELL 52 15 29%
6382 LVI-28-AGI LVIVAGMNVLNGALYLQLVVSIMRNTFAFLNAGI 42 13 31%
6383 LVD-29-AKL LVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKL 34 16 47%
6384 LDA-29-LSL LDALKESLAELYFFWRGVGDADALRFLKGFTFLSL 44 7 16%
6385 VIV-26-DAI VIVQYGGQTPLKLARALEAAGVPIIGTSPDAI 31 20 65%
6386 GIT-29-ILD GITALQMDIKIDGITPEILEEALAQAKKARFEILD 27 17 63%
6387 LGL-27-ADL LGLVRDPVAGLVEFRELAREAGGALAARATADL 58 17 29%
6388 ELL-27-LLK ELLDLLDDVGKDLKKLAAFAPGHTPCGIEELLK 64 6 9%
6389 LVL-29-LLD LVLLSYLLLNVIFLILSWRLVKLPEASVSLRNLLD 60 11 18%
6390 LIA-27-ILA LIAFGLELAIFPDNVILFALLWVALALLLVILA 59 8 14%
6391 VIG-28-GVS VIGGAAAIAILLSFIGKDAALIQYIPTPVMGGVS 35 14 40%
6392 LTG-25-FLG LTGKGVHVVTVNDYLAQRDAENMGPLFEFLG 32 16 50%
6393 VEL-28-LDI VELGKRYYEQKDESALPRGIAVKAAFENAMTLDI 29 15 52%
6394 LEV-26-LLT LEVEQRVLAHPLYPVLTSMPGVGVRTAARLLT 34 11 32%
6395 LDV-29-VIA LDVTIQAQILDLLRDLRKEGGTAVLLITHDLGVIA 32 19 59%
6396 IAT-27-ALK IATGFVVDAANVAIENISRYIEKGEEPAAAALK 33 8 24%
6397 GDL-29-DLI GDLEAAKTLILSHLRFVVHIARNYAGYGLPQADLI 29 19 66%
6398 TIA-25-VGL TIAAEGVLIDSIGPLALEALLIIALSELVGL 35 7 20%
6399 LSL-25-EAI LSLQDNLMRIFASDRADSMLQKLGLTEGEAI 45 12 27%
6400 LIG-25-IVV LIGTFAVMALLGFSINTLSLFGLVLAIGIVV 37 13 35%
6401 ALG-27-LVD ALGAAGEGPALILLKTPRPQPGNDRKRLARLVD 47 12 26%
6402 LLK-26-EAL LLKCLFGIYLKDEGTILFAGKELDFKSAKEAL 54 10 19%
6403 VLG-25-VIL VLGLIGMGFAAGILLQLLQLSLGLGAAGVIL 42 4 10%
6404 LAE-26-EIV LAEGLSPAHSILWNGPVSVLKSVNFRKADEIV 41 15 37%
6405 ASL-24-LEA ASLAAGLELISEPLGGLVGYAPRAKRSLEA 48 7 15%
6406 VGL-24-AAI VGLTLLVAALFRLGADSALLVALSAIGAAI 54 6 11%
6407 TLA-26-ADL TLAAIKMAKDAGYTAVISHRSGETEDATIADL 51 15 29%
6408 IVG-27-SGL IVGSRNASVVGLEFARKLARELAEAGFVIVSGL 35 13 37%
6409 ITL-28-AVL ITLAAFLGAEGAVSVRARATAIRAGAAAGLLAVL 52 10 19%
6410 LSL-25-DAL LSLRAVAIVLAAHLFSIGVAEAIEGTLRDAL 50 10 20%
6411 SLA-26-VVI SLAGRNTSARTTSMLAAMGLAGGSFFYGEVVI 39 7 18%
6412 GVL-25-LGG GVLLGQFYGVALPYAGFIAGLKAFTAAVLGG 57 15 26%
6413 LVS-28-AVL LVSVTERTREIGIRMAVGARASDVLQQFLIEAVL 55 13 24%
6414 VIG-25-DLA VIGGGINGAGIAADAAGRGLSVLLLEADDLA 41 18 44%
6415 EAI-29-LVS EAIFFFLPVGICWSVVKKMGGTQILGIVLGITLVS 36 19 53%
6416 IEA-29-EIA IEAARAGEQGRGFAVVADEVRKLAERGLEATGEIA 37 11 30%
6417 GGI-29-ELG GGILVNKNGYRYLQDYGMGPETPLGIPKNKYMELG 32 12 38%
6418 NAL-25-LLP NALIEGPFALLEARRAMGAAPLGVLRGTLLP 34 7 21%
6419 FLA-27-GLD FLATKISFINEIANLCEKVGADVQKVADGIGLD 36 23 64%
6420 IPL-25-TLA IPLEANIAAAILREWVPGIPLWAFSLVGTLA 35 7 20%
6421 LNA-24-VIL LNALNLELIGALDAALDAIETDEDVAAVIL 30 6 20%
6422 TLL-29-LLR TLLGSALSAHLGASLLTGIVFGLALSQARTVVLLR 55 12 22%
6423 ALG-28-ADL ALGIGLGALVIALKALGRGLAVLADLAADQQADL 60 7 12%
6425 LVL-27-GAI LVLMAEAFPADLLAVGDISGGGLMVIFSLGGAI 51 13 25%
6426 IAL-29-ELL IALFPNLTVEENIAIIPEMKKWTKEEIRERVIELL 53 17 32%
6427 AVL-27-IGV AVLLGDDIVEAEGPALKQLIDVYEGTLSSVIGV 48 14 29%
6428 LGG-29-DLV LGGHMASFQSSATIYEVCFNHFFRARNEKDGGDLV 41 19 46%
6429 LDL-24-LLR LDLARRAGLRGGLVGLLGAGTGLLLSLLLR 50 5 10%
6430 EVL-25-VID EVLTGLEPVRRRPGMYTDTTRPNHLAQEVID 35 17 49%
6431 LVE-25-VIE LVEGETETGAINVLAGACGSHFDAEGAKVIE 34 7 21%
6432 LIE-29-ALV LIENSSGKHKAETTISKRGRKLLRSVLFNAVMALV 42 6 14%
6433 GIG-25-GID GIGFDTAAALLVIGASTSINIAEFTAEWGID 33 7 21%
6434 GSL-28-LNA GSLAGATWSGIATVLPFILLGAVLAPALARGLNA 31 8 26%
6435 LGS-26-LGG LGSSFAFIGVVIAATGDLGAGPLPVISIALGG 43 8 19%
6436 ISG-26-LAL ISGATLGRINLVVSIAAELVLLAYQLFWTLAL 48 6 13%
6437 GLD-26-SGL GLDYLTLSRAAGTLSGGEAQRIRLASQIGSGL 35 21 60%
6438 GLD-29-GVS GLDAEAAFEADADKIEADGTGNRSVNYRLRDWGVS 32 14 44%
6439 VGI-24-ILL VGILLIPALLGLFVAIATLITLSFKQVILL 40 5 13%
6440 SGI-25-LDG SGINLVGVAEGYQPLALAKHAGIGSSAGLDG 29 5 17%
6441 GID-24-TGL GIDRAVFARLFEPFWRADSSRSRVTGGTGL 31 16 52%
6442 VLL-28-GGG VLLAEAEATLRLFLALTLVQLFSYSALAIVHGGG 50 17 34%
6443 LLE-29-LTI LLEAVQGLFERPAELATTVAERILAAPRREIRLTI 33 10 30%
6444 LSG-24-AIE LSGGEIQAQFEFAKAELKLRKRFGQLQAIE 41 9 22%
6445 AIA-29-LLE AIARALVNNPKLLIADEPTGNLDPEISWEIMALLE 58 22 38%
6446 ILL-28-SLG ILLNSHDGISLYQALPGYFRFILQNGLVCGQSLG 47 8 17%
6447 EVL-26-EAL EVLTPADDEFHIDKWEFTVPFVCGARNLGEAL 59 29 49%
6448 IAA-26-GIE IAAKAEDGESCVTYIGPDGAGHYVKMVHNGIE 40 15 38%
6449 GAL-29-LFG GALAVVTFTDLLDKLAPGDLLVANNTRVIGARLFG 51 8 16%
6450 GGG-27-IEA GGGSSYTPELIEGAIKRLSELPRMEICLVDIEA 36 13 36%
6451 EIA-24-VGK EIARRLAKLANAPFIKVEATKFTEVGYVGK 28 21 75%
6452 EIL-25-GVV EILLVVDAMIGQDAVNVAEEFNEQLSITGVV 33 16 48%
6453 AIG-24-IEA AIGSGKAAKTEKGAEALGALQGIDEGVIEA 33 5 15%
6454 ELG-28-EIL ELGDALPLPLREYSTGIVVRLAGGQDTARAPEIL 35 15 43%
6455 GIV-28-LDA GIVVFLIAEIVQFEVITKGAGRVAEVEARFALDA 36 9 25%
6456 GVV-29-GVG GVVDIGDGLAVAFKVESHNHPSAIEPYQGAATGVG 41 20 49%
6457 ILD-24-LLK ILDDINLSLLKGEIIAIVGPNGAGKSTLLK 40 13 33%
6458 VIV-27-VIE VIVAMTLEEAEAAVRDMLAGNAFGDAGARVVIE 29 20 69%
6459 LFG-25-TLL LFGTADGWGIWKLTIGAAFGTLAGNALITLL 41 9 22%
6460 SGV-27-ALV SGVLLVAKKRSALRSLHEQLRERGMQKDYLALV 43 15 35%
6461 LAL-28-RLI LALLAAELAAALGDIASLVAIARLLGLVELQRLI 51 2 4%
6462 VLL-25-ITA VLLAIFFAIGFGGVLMGVDIGFIFIGLFITA 39 14 36%
6463 ALE-26-TLL ALELARILELLLADLEVLVRAGARGALKLTLL 49 3 6%
6464 ALE-26-TLA ALEASVRYLAADLGPRGIRVNAISAGPIKTLA 51 24 47%
6465 LGV-29-IAG LGVAAAILAGIGILLIALASVLLVDEALSLLAIAG 52 7 13%
6466 GLG-24-VGL GLGLIAAHLALGALAAANAQAACDFIPVGL 56 7 13%
6467 GLA-29-VIL GLADKLSAYPRALSGGQQQRVAIARALAMRPEVIL 47 16 34%
6468 VVL-26-LID VVLDEATLFLIAVAPDYQRQGLGRRLLEHLID 36 7 19%
6469 LSV-27-LGF LSVGLILLGALSGAGLEAYLADITLATNNELGF 35 8 23%
6470 GVG-28-LDV GVGKTAVVEGLAQKIVDGDVPQKLQGKEVIRLDV 32 23 72%
6471 GVS-28-LAI GVSDEDLELLFRPFYRTDEVRDRESGGTGLGLAI 41 16 39%
6472 VGI-29-ALS VGIGFGIYGLVPILRAISAFALAALLAVLDAVALS 43 13 30%
6473 NVL-25-FGL NVLVCTTIIETGIDIPNANTIIIERADHFGL 29 21 72%
6474 RLL-25-SLL RLLSDILEFELAELLLLLIAEAAILPLASLL 59 2 3%
6475 ALA-28-GFL ALAAALAQSLASAAGLEIIVTRAVVALGLDIGFL 56 8 14%
6476 ILA-26-IAA ILAAALGLILVRLNGAVFPGAQAEALLDAIAA 60 7 12%
6477 ALK-26-NLL ALKNVVLLIFCDEGDAVQGESGIGKATLDNLL 40 13 33%
6478 VLG-27-ALI VLGIIAAIAFDRKSASLSLIFKLGIMAQTIALI 57 5 9%
6479 LEL-28-LVA LELGDGVFEVLSTAGDNKLGGDDFDQKIIDYLVA 47 12 26%
6480 LEL-25-SGL LELVINFELAAVPEGHVGRGGKTLRAGASGL 37 6 16%
6481 LVS-28-LGA LVSGAAAKVDQAEAYENNDLGAQTLLGVATLLGA 47 7 15%
6482 GGG-28-GAI GGGALGAAASGVLQALAELGGKPDAVAGTSAGAI 42 16 38%
6483 LTG-25-LEV LTGGLAGMAKARKVKVVAGLGSFDGANTLEV 33 10 30%
6484 EAI-25-NLL EAIKHPWINKALEKAQKKVEARNLEIRKNLL 32 9 28%
6485 PLL-26-LLF PLLEEVLVAAAVAVLALATAALPTVTRLPLLF 42 10 24%
6486 DLV-26-DLA DLVQPGHIFPLAAQAGGGLTRAGHTEAGCDLA 38 8 21%
6487 AIS-27-AKL AISLRLRKLREADNTTGDLDELGDRSLALIAKL 31 13 42%
6488 LGF-28-VLE LGFMCGAGAMLLKIFAFPLRLTIGTDIDTAEVLE 31 6 19%
6489 RIL-27-VVL RILLEKHNGEVPEDRAALEALPGVGRKTANVVL 38 18 47%
6490 IAD-28-DVL IADASSTETAAVVDHKVVLAVPGFSAADTGSDVL 36 14 39%
6491 EIV-25-EAL EIVPVNAQTRKGELVVGLDEFPRAATLLEAL 42 9 21%
6492 FGL-27-GLL FGLHGAQFRGGALAAGGSNDKGKLKLYRGLGLL 53 15 28%
6493 IPL-28-GLL IPLVLALTFALMEYLGISLQRISLGALIIALGLL 42 16 38%
6494 GLF-26-IVL GLFDGDALSGERLMDFATAFLLFVFLLLFIVL 32 12 38%
6495 LVL-29-ILD LVLLGSLISILIGVPLGIWMAKSATVAQIVNPILD 37 15 41%
6496 ALE-29-SLA ALEAAGSEELLVIISRVDDTAGALDVKLELERSLA 49 4 8%
6497 IAS-26-LAE IASYQGSNNDVERQRESAEKESRLKPAGTLAE 42 14 33%
6498 LAT-27-LIV LATWMRGLSNDVYFQVGLLTTIGLSAKNAILIV 39 15 38%
6499 LGS-25-LTL LGSEAVRRVFTKTAQLWHNATPHPHWCGLTL 41 17 41%
6500 LDA-27-AIG LDAVNAGDEVDDRGFIRVDKQLRTNEPHIEAIG 41 8 20%
6501 IAT-26-LGV IATVIGDVHDNGKNIVGVVLTCNNGEIRDLGV 40 8 20%
6502 IAV-24-VVI IAVLSAIGRDTGGMSIQFAVGALGGALVVI 40 18 45%
6503 VGI-25-VGI VGIVSRSGTLTYEAVKQTTDEGFGQSTCVGI 34 22 65%
6504 TIA-25-EVI TIAAEDILHDLGAFSMISSDSQAMGRVGEVI 27 16 59%
6505 DVI-28-IGG DVIEKVIKAVIPAGYLDDVTKFFINPTGRFVIGG 29 10 34%
6506 LAK-26-LTI LAKELLETGEILKEGNRMIEGQVPKVHVLLTI 30 7 23%
6507 EIV-28-IVL EIVRGGIFAVDKGQFEAATALGFTHGQTMRKIVL 31 11 35%
6508 LLG-28-AIE LLGKRVDFSGRSVIAVGPTLKMYQCGVPREMAIE 43 14 33%
6509 VLA-29-DLI VLAVATVDFGVLMILAGPDILSRGFGYMRESGDLI 40 9 23%
6510 LAS-24-LLK LASHPLVLLCDEATSALDPATTESILELLK 46 12 26%
6511 AVL-24-TLI AVLEGLGGALADGRDVFHAGLSSPQVGTLI 41 7 17%
6512 IGL-26-LPL IGLRDIIKPGVAMWEVEGYVRRRCKEENRLPL 46 9 20%
6514 IAS-28-GLG IASASGELLFPELVLFAIGLTLSTGDLLLLGGLG 39 6 15%
6515 ATL-27-LSG ATLLSRPEAGRYADVLGRKKIVVFGLAGCFLSG 48 8 17%
6516 IAV-28-LAT IAVPNDATNESRALYLLDEAGLIGLAVEGGTLAT 37 10 27%
6518 LLE-27-ALI LLERVGLLEAAKKKVSKLSGGMRQRLGLARALI 49 24 49%
6519 EAL-29-ISG EALKQALGDLRGICRFVFLLPSDEGLARCALDISG 37 6 16%
6520 LGV-28-ISA LGVDIVLECTGLFTLKEKAEKHLFAGAKKVVISA 36 16 44%
6521 GLV-29-LDI GLVGFSVSNLRIPGFEQPWEEDFGKPERIVTALDI 30 11 37%
6522 LVS-27-VAI LVSSANIACGFHAGDAQSTAAIVRELIENGVAI 35 7 20%
6523 AAI-24-ALN AAIIFVRTKNATLEVAEALERNGYNSAALN 36 9 25%
6524 GAL-25-SLG GALVGGLIIFLAGLLAALVALLRGIGGGSLG 61 6 10%
6526 TLA-25-GKL TLAAAESWRDKATGEIKEKTEWHAVVLFGKL 37 10 27%
6527 IVA-25-AVL IVALITHLLALAVIIAVLEGGIGSGAAIAVL 55 5 9%
6528 IGG-27-DLL IGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLL 37 17 46%
6529 LLF-25-LVG LLFVAGILRLNGLNVAIICFSVEIIILLLVG 45 6 13%
6530 FLL-29-LLF FLLWLLSELFEQLPEVGDLDKPKLVFFFDEAHLLF 46 19 41%
6531 NLL-29-LIG NLLTKNVKVVGEPPEEPSLLASIFISWFPMLLLIG 40 8 20%
6532 GVI-24-GAI GVILLMGGAVLAFSLKDLAPWLAIAILGAI 37 7 19%
6533 IGV-29-LVG IGVVAQFLIMPLVAQLILKSLHLIPEIAVGVILVG 42 11 26%
6534 LGF-28-LIA LGFILALLRFSLTGGFRDLARAKISIFRGTLLIA 42 13 31%
6535 NAL-24-GLD NALLADQFLEYFDGFSIGSNDMTQLALGLD 30 13 43%
6536 SVV-28-DLI SVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLI 27 15 56%
6537 VFL-27-ASG VFLENYNVSLAEKLIPAADISEQISTAGKEASG 29 15 52%
6538 LGI-29-LLI LGILVDLPTALLLSVVAKLNACQASPSAALSGLLI 53 18 34%
6539 LAA-26-GKL LAAPAGPRATLGLDPGIRTGVKVAVVDATGKL 57 15 26%
6540 LLL-27-ITA LLLDAAMAKLAEEAGVLLAVKEPLLTKALAITA 52 6 12%
6541 LGL-29-IGG LGLPSEEADKGIGVSACATCDGFFYTNQVVAVIGG 54 12 22%
6542 LAL-25-IVV LALLVALGLPGLVALFRRRGVLRPGAITIVV 51 6 12%
6543 LLV-24-IAT LLVLRGIALLLDAALLGVGLANLQLNIIAT 41 6 15%
6544 GLG-28-GAS GLGLGPASAGAIGLGQALYLFAFGPGNGGLGGAS 44 4 9%
6545 ALK-26-GVS ALKLGAAKAIGIDIDPQAIQALRANAERNGVS 34 7 21%
6546 LGG-26-AIG LGGAITVVATAPLSSMALTALLGLTGLPMAIG 48 13 27%
6547 ILG-28-AVL ILGIAAAGLLKGADFAFALRLFAIAAGFGSLAVL 50 12 24%
6548 LVE-27-GAI LVEINEAFAAQVLAVLKDLGLDPDIVNVNGGAI 33 21 64%
6549 VSL-24-VLG VSLSLKIGEILTALGLSGAGKSTLVGVVLG 47 8 17%
6550 KLA-26-AGI KLALQPIAESLLLQGPLEPTNEPYAIAKIAGI 35 11 31%
6551 ELG-29-ILL ELGDFIDEPLRTYSRGMVLRLAFSVVTSLIPEILL 35 14 40%
6552 GGI-25-LLR GGIASCNVLAQQVLALLLPEDAGGNILNLLR 35 6 17%
6553 TLI-24-VID TLIHLRDLGNTVIVVEHDEDAIGAADHVID 29 7 24%
6554 IGV-27-FGL IGVIGVMIGFKAFTKALFFQVNDFDAPLIPFGL 34 15 44%
6555 NAL-27-ITL NALLNVTGTASFASEQTDLTIEPSSKGERIITL 28 6 21%
6556 SGV-26-TIA SGVIEKTAMVFGQMNEPPGARMRVALTGLTIA 29 16 55%
6557 DAI-25-LDV DAIICTGRSDYPNQVNNVLCFPFIFRGALDV 30 19 63%
6558 IPL-25-IVA IPLSASLFLNNKPPALRLIAGALWLMGVIVA 32 6 19%
6559 ALL-24-EIA ALLAALGLAHARGAAALGLSVGERLLVEIA 53 6 11%
6560 LAL-28-LDV LALEKQLLAELFDLLLPHLEELQLLALALAALDV 51 12 24%
6561 LLD-29-SLA LLDALRVLAITGLISALLIGTDADLEVGRLVLSLA 54 10 19%
6562 ALS-28-DAI ALSGVFYAFGGLLEAGRIGSATNNLGFMYELDAI 36 12 33%
6563 ILA-27-SLL ILAIYPLLVSEFSLLFARIGSILLVFLLSLSLL 54 15 28%
6564 LIG-27-VSG LIGGVIGAGGSILLLDAIAQVVIAGLVTLYVSG 38 11 29%
6565 ALE-26-ALI ALEGALKLKEIAYIHAEGYAAGELKHGPLALI 52 23 44%
6566 LGV-27-IAV LGVLLLAEGEEHVEATANLLLRKPDAKAVAIAV 46 12 26%
6567 ILG-24-AGI ILGGPINGLIPGIAREVVVGGRIACLQAGI 47 12 26%
6568 GGG-27-LID GGGATFAALIVLPAMGLPVTLVALLISVEPLID 34 20 59%
6569 LLR-29-AIE LLRAAGIIAALEVVIFELLAELKRPLEESLAEAIE 35 5 14%
6570 AIV-27-GLG AIVPTDVGQHQMWAALFYPAKNPEQVVTSGGLG 43 14 33%
6572 VSG-28-AGI VSGIGFLGAGIIGIRGKIVAGLPTAAGLWATAGI 42 10 24%
6573 VVI-26-VLA VVIPNIANSYFSILAIGIDDIANMYKRNIVLA 41 8 20%
6574 VGI-26-AIG VGIICALFWAVSSNMTVEATQRLTGGGGFAIG 35 6 17%
6575 GDL-25-ALT GDLLRAVTIGIAGLAELGRLVLVGAGALALT 42 3 7%
6576 TIA-28-SAL TIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSAL 39 15 38%
6577 FLG-24-VLA FLGAALLMIEVNGIIAAQVPGFDEALLVLA 45 6 13%
6578 SLL-24-GIL SLLSGANDPIKRAIRTRKMGGGGMRQAGIL 51 11 22%
6579 EAL-29-IVA EALRGEGAYLKRPDGSRFMPDFDERGELAPRDIVA 44 12 27%
6580 LLV-24-DIL LLVFDEVQCGMGRTGDLFAYVHYGVTPDIL 34 12 35%
6581 GLV-24-IGV GLVILALICSFPLLSPFLGPGAVIAQVIGV 37 7 19%
6582 GVL-24-LLE GVLERQFRNYYKEAARLKGNTGENLLQLLE 51 25 49%
6583 LIE-28-IGL LIERNLRLVVYIAKKFENTGEDMEDLISIGTIGL 35 25 71%
6584 VSL-27-IVV VSLIGTFAVLLALGFSLNTLSLFGLVLAIGIVV 35 18 51%
6585 VIG-26-IAA VIGKGGGAIRALTEETGTTIEIPDDGTPKIAA 48 16 33%
6586 GGG-25-GIG GGGHGGHGGLIDGISKLGNNCNFRRLRPGIG 45 16 36%
6587 GIG-24-LVL GIGLAATQVDIHQAIIVIDLSENRDAALVL 51 12 24%
6588 VLI-28-VFL VLIRGLRAVADFEYELGLANMNRPLVPVLESVFL 30 7 23%
6589 GSG-24-LVL GSGGANLIAALARFSIPAAARLLRGNTLVL 41 6 15%
6590 ELG-29-ELG ELGLKLVFIVHDLLAVDRISDRVLVEKRKLAVELG 39 4 10%
6591 LLF-26-ALG LLFSWVLLVLLVRAEFLRLRNASYVLAARALG 50 11 22%
6592 IAV-28-LGV IAVGAGALHGLTFGDNAKAAVGTAGAAEITGLGV 48 9 19%
6593 GVS-27-VLV GVSGAVASGLVFNPLIDRDVMRKMTGTKNGVLV 40 13 33%
6594 VGI-28-IVS VGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVS 31 17 55%
6595 VID-26-LID VIDVYPIKGAVKNAETGALLALFELKTDVLID 33 8 24%
6596 LDV-29-IAT LDVETLRALEEALLEFAGCAMVISHDRWFLDRIAT 27 14 52%
6597 FLG-26-LPL FLGLALLTKLSTAIKFVLPKVGILLDAGILPL 36 12 33%
6598 LGV-26-AAI LGVLLVEEGELLQDAEIGAIKAGTRAIDTAAI 60 8 13%
6599 GLL-27-GVI GLLVAGLDGGLSMILTTPLARAAVGAAIEIGVI 49 5 10%
6600 LIA-25-GIV LIAVYADLALRVDTALHLGLLEAGMGSKGIV 47 11 23%
6601 ILA-29-GAL ILAAAGLERMGHLAEIETAYLLALLVLPAIGQGAL 57 11 19%
6602 EVL-25-NAL EVLREDYIRTARAKGLSEMRVVFVHALRNAL 31 18 58%
6603 GLV-29-GLS GLVLSETAFADRLEVLLVLFRDFFAAAFLFLLGLS 49 5 10%
6604 GVL-27-VIE GVLLVNLGTTVGTGKAEMARLLGVFLSDDRVIE 34 8 24%
6605 GIL-27-LGI GILVPGGFGDRGVEGKILAIQYARENGVPFLGI 54 14 26%
6606 LLR-29-LLV LLRDINKETVEFVDNYDDTTLEPVVLPARFPNLLV 62 19 31%
6607 GIV-26-GLV GIVINDSMQTSDPDIYAVGECAEHNGKVYGLV 42 22 52%
6608 DLA-26-LLK DLASRDGVARSALGEILAGKGVLLKLLLVLLK 46 6 13%
6609 ATL-28-LVG ATLLHDDVVDESDMRRGKATANAAWGNAASVLVG 57 27 47%
6610 GAI-24-KLA GAICTRRCPFCDVAHGRPVAPDAEEPLKLA 34 13 38%
6611 GGI-27-ILV GGIEIIAIIAGSAKNPLASAPSAISAVIMGILV 36 13 36%
6612 GDL-28-LGA GDLIRAFAIDLAFKDLGIAGYSANGSEVAAALGA 42 6 14%
6613 LNA-28-LLL LNAFFAFGVVAAMGLLWQVGMGAIFVGAIGLLLL 45 11 24%
6614 AGL-26-SVL AGLLAAAGILPAAVTIIISLIALAGTLSGSVL 55 6 11%
6615 LGA-26-LLE LGALRLLLAKEAGLGDEALFNFLGVTDWLLLE 55 8 15%
6616 IGL-24-ELV IGLVIPELNGKLDGAAQRVPVPTGSVTELV 41 20 49%
6617 GVL-28-LLP GVLTLVDSLVMGIAVLRGMAGQISWGLTLFALLP 49 13 27%
6618 VGL-24-ALS VGLSHNMADGAPFLGSGGKIVRGLIARALS 51 12 24%
6619 GSL-25-GVL GSLKSNIGHTQAAAGVGGVIKMVTALRHGVL 45 16 36%
6620 LLN-24-LLG LLNGLRDRIVLQCDGQLKTGRAVVILALLG 44 8 18%
6621 DLA-29-LVA DLALAYSPGVAAPCLEIEKDPLAAYKYTARGNLVA 55 22 40%
6622 GIS-28-LTL GISIKLSALHPRYSRAQYERVMEELYPRLKSLTL 35 9 26%
6623 DIL-26-ALV DILFFDVRTNDAPLLSLSWLAQLLALYGSALV 37 5 14%
6624 VVS-26-LAE VVSSAIKADNPELVAAREARIPVVRRAEMLAE 43 27 63%
6625 TLG-25-IAA TLGSIGVLASVDGEGQAVQGFAVLAVDTIAA 48 8 17%
6626 TLG-24-GIA TLGISLHNFGEGILGFVTASSNLELGAGIA 36 6 17%
6627 LSA-25-LEV LSADDLETLEKAAVEAFALGYEVTDPEELEV 35 7 20%
6628 LAI-29-GGS LAIEGKQFSSEEFSELIDELAIYGKSKITFVIGGS 35 19 54%
6629 LEL-28-IAV LELAAGIKEKRGAVALFITGDLAAARYQADRIAV 33 11 33%
6630 LEL-26-DIL LELINPVESAFVDGKIIRALQAALFAVLRDIL 34 9 26%
6631 LLR-24-LLD LLRDGADFRGVDGVMELQLGWPEGAAYLLD 54 8 15%
6632 IVG-24-ALN IVGSAADSKALTHVKVLKIDEEQQAELALN 28 16 57%
6633 LGF-29-LSV LGFEIVGDAVITAIGISKELIEELALLIGLPLLSV 34 7 21%
6634 EIV-29-GVL EIVGIKETQKTTCTGVEMFRKLLDEGRAGENVGVL 32 24 75%
6636 VLA-27-GLF VLAIGYAAVAMSGLKAALGFIGLLAIAVGNGLF 42 11 26%
6637 LAI-26-LVD LAIIDKRRPAANVALVMNSLGALIGALGLLVD 36 16 44%
6638 VAL-27-AIG VALVPADSPISLSGIIFYNTLFDENASCHLAIG 50 15 30%
6639 LGA-24-LGT LGALLGALLVVLLSRPHYLATTNPAAILGT 46 7 15%
6640 VVL-28-IGA VVLEKALGAPLITNDGVSIAKEIELEDPYELIGA 44 9 20%
6641 IAA-24-VLI IAALIAAVKVTFAPVLILNAAAIYLGPVLI 43 2 5%
6642 VLI-28-LLV VLIDTAGRLQIDEKLMLELRDVKALAQPLEILLV 50 12 24%
6643 KLA-27-VID KLARAISLQGWREFRVLVEAKCNKLNREFIVID 31 13 42%
6644 EIL-28-DLL EILAFETGAQGEGAGQGDAQLVRLENILEDADLL 43 7 16%
6645 AIV-28-LGT AIVATDVGQHQMWAAQFYPFKNPRQWLTSGGLGT 33 14 42%
6646 IGG-27-IAS IGGKQALETVQRLLPVLCQAHGLTPEQVVAIAS 36 22 61%
6647 LVD-29-LVA LVDIYGVGVLITGESGVGKSETALELVKRGHRLVA 43 14 33%
6648 GVV-29-VAL GVVAGGGVALIRAAGKIADLAGQNEGQNVGIKVAL 50 12 24%
6649 ADL-29-VID ADLPGLIEGASQGVGLGTQFLRHIERTRVILHVID 34 15 44%
6650 VDL-29-LGI VDLPFALPTAVAGIALATLYAENGWIGNLLEPLGI 34 11 32%
6651 VIE-27-GKL VIENLQNLLAAGDELLKFSGILSGSLSYIFGKL 28 12 43%
6652 ITA-26-LIG ITAIESLYSKEGCPAYHPRPLLKILLYGYLIG 39 10 26%
6653 GIE-26-TGL GIEVTASHNPMDYNGMKLVREGARPISGDTGL 27 10 37%
6654 LNA-26-ILD LNANYIAKRLAPAYPVLYTGRDGLVAHECILD 27 18 67%
6655 IVD-26-AVL IVDEPTRGVDVSAAADIYQLLLSIAAINVAVL 37 8 22%
6656 LGY-29-LLA LGYREIKQTMQLSRLTLRSKKPELVEQELWGVLLA 45 20 44%
6657 LIA-25-GIT LIAVGLFIAGYSMWTTIILTAILVAGQWGIT 37 6 16%
6658 GLV-27-VLT GLVMVLQGGTNAEVAGDTAAIITGPLLTAEVLT 40 6 15%
6659 VIA-28-DAL VIADAFLQQILLRPAEYDVIACDNLNGDYISDAL 52 12 23%
6660 LIE-29-LLG LIEAIVLVFLVMYLFLQNIRATLIPTIAVPVALLG 43 12 28%
6661 VIG-27-ALG VIGFGIIGTGGDAKERGGALGADGLAGARAALG 53 6 11%
6662 DAL-25-ASG DALDDSRAAHILRRHEQAAALAARGLARASG 44 9 20%
6663 GSG-27-AAI GSGGALALGVADPISMLENSVFSVISPEGAAAI 40 16 40%
6664 IVA-27-GAL IVAAGSGAALPRLKGSSRPVAPLEQVTIVLGAL 49 10 20%
6665 AIE-28-LGA AIELALARLRDGDGAAAILFGADILEVALLGLGA 39 2 5%
6666 GVG-28-ELG GVGRPSTYAPTLEGIQVRYYVGLAAKRFEPTELG 36 12 33%
6667 GVG-25-DIL GVGTKLKLAIDYDKHDTIGIDLVAMCVNDIL 27 19 70%
6668 GIS-24-GLI GISRRIEGDERTELKEALASLELPEGMGLI 38 18 47%
6669 ITL-26-LTL ITLMLPLEVRILPLNEVIAQLGILDIGAGLTL 38 10 26%
6670 RLI-25-LAA RLIQGKNFTDTANQFQTSVTTAMRRFDQLAA 56 16 29%
6671 ADL-28-DVI ADLNWRNPDVREELYKVVNFWRDKGVKGFRFDVI 38 23 61%
6672 SIA-25-IVA SIADAPALAPALIGGGLAADLGAGFLGVIVA 32 8 25%
6673 IAD-24-VLL IADHIKALAKAGGFGGEHSGVNSETQNVLL 34 8 24%
6674 EIV-24-VLI EIVETAKRTGAQVRGPIPLPTRKERFTVLI 30 16 53%
6675 GDL-27-LAI GDLAILKAVLEHSTTKIELYNLDKAIEKGDLAI 32 9 28%
6676 FLG-27-SGV FLGGPPLVKAATGESVTAEELGGADVHSRYSGV 28 12 43%
6677 LGL-24-LIE LGLAKLSAQPVAVIVTSGTAVANLYPALIE 49 7 14%
6678 LGL-25-ELG LGLGGYLALPFVEAPDKLGILDGVSLLRELG 54 24 44%
6679 SLL-28-LAT SLLIANLAIAISAVGLGTELIGALLSPVQILLAT 51 7 14%
6680 LLI-29-LID LLILFPLGFLAWSQRLSRFLLSDQATAGNTLLLID 37 13 35%
6681 SGL-27-SLG SGLLIALELLLDLVGLFIEMAILVIDLIAISLG 41 6 15%
6682 IVA-26-IAS IVACGTSYHAGMVARYWFEKLAGIPVDVEIAS 35 13 37%
6683 LLG-29-DIV LLGPNGAGKSTLIARELGLTLPDDGRVVVLESDIV 35 8 23%
6684 ELL-27-LIA ELLAEVIRQVGGLFAAVAADLLALGALALGLIA 55 12 22%
6685 EAL-26-ALT EALARRSDGGLTLIVALGVAGTNVGAELHALT 53 6 11%
6686 ALI-29-ILG ALIVATIIISSAGFLAALVLVNLGAPGALLLLILG 51 4 8%
6687 LLK-24-LDA LLKVRRIGLKGFEQDAGFLRIIAGLLPLDA 41 20 49%
6688 AVL-26-DIL AVLPILALYIVAAEEQGVAPEKLAGTIQNDIL 36 14 39%
6689 AGI-28-ALS AGISGLPNGRFQFFNALAGLLAVVVVASLGAALS 48 7 15%
6690 LVE-27-IGL LVEPAAVGAHAVMVADLKLGKKVAVLGAGPIGL 35 14 40%
6691 LVE-28-IAD LVERAGNGISGGGSITAFYTVLTEGDDQQDPIAD 33 18 55%
6692 SGL-26-IAL SGLLFPAKNDLARLAPADLLKDLSLYALYIAL 49 12 24%
6693 EIA-29-ELL EIAAASERLIGEFLDALDAVEALRTELSARGTELL 46 11 24%
6694 DVL-29-ILV DVLGMAQTGSGKTAAFSLPLLHNLDPDLKAPQILV 29 9 31%
6695 IGA-25-LVV IGAARVGYINDQYVLNPTQDELKESKLDLVV 47 21 45%
6696 AIG-29-VLD AIGIVDMEGVLAENPEAIEKSAARIQEWEAQVVLD 33 13 39%
6697 AIG-25-GLF AIGYALTGASLLDPGIIYIALAAIAVGNGLF 33 11 33%
6698 LLP-24-TLA LLPALIDGGLILGFNRLGGDPCRLAGGTLA 51 6 12%
6699 GIV-29-VLF GIVPLVLTFVIKIVGLDISFAFLITAPIINLGVLF 29 13 45%
6700 ELI-29-LSG ELIVMAKQALLNDGDEVLDPAPDYPLWTAAVALSG 36 9 25%
6701 GVG-29-GVI GVGIGGVLEPLQANATIKEDVCFIGARKEIVEGVI 43 14 33%
6702 TLG-27-TLI TLGHIALIMGLGAMLGKLLADGGGAQRIATTLI 30 18 60%
6703 VIE-24-EGL VIEILNRRTKNNPVLIGEPGVGKTAVVEGL 30 24 80%
6704 GIE-29-ALG GIEIPNQKRQMVYLREILESPDFEESKSPLTLALG 38 29 76%
6705 GSI-24-GSI GSITGAPKVRAMEIIDELEPQRRGAYCGSI 30 18 60%
6706 VFL-25-LSL VFLLLFFLLDLTITMLGVLKLVIALLVFLSL 40 1 3%
6707 LGY-28-GAL LGYGLAAAQGDATILDIAKLADVFYIGGTKGGAL 34 8 24%
6708 LLE-28-LVA LLEALTRAERALTVGIADCYLKAVSTRRVLDLVA 54 8 15%
6709 LLI-28-LAK LLIGDEVLTGLGRTGLLFAFQHLGADPDIITLAK 43 12 28%
6710 LLT-27-VIL LLTEAREWPGADRPRRAGVSSFGISGTNAHVIL 44 15 34%
6711 VLV-29-IGL VLVYVSLLAGNFGGDSIALVAIGFLIAGPVMLIGL 46 6 13%
6712 GLV-26-AGI GLVEQTNAALLNEKANKDSKVIPTQRGLLAGI 50 8 16%
6713 VGL-29-EIV VGLVDGCARMGLKISPEGINSALYHRHKNCDPEIV 30 15 50%
6714 GIG-24-ALI GIGIEEILEQIVEKVPAPAGDVDAPLKALI 56 22 39%
6715 GIA-29-KLA GIAQAALDAALAYAKEREQFGKPIAAQQGIAFKLA 35 18 51%
6716 EAI-28-ELV EAILREIDRGGQVYYLYNDVENIQKAVADLAELV 36 13 36%
6717 ELG-25-LNA ELGGKSPAIVDADADLDVAAARIAWGKFLNA 31 19 61%
6718 LVI-29-IAA LVIANARLSGRSAAGYLLLGAFARRLLRVITLIAA 47 7 15%
6719 IVG-24-GSI IVGIAGINGNGQSELIRAITGLRKPDSGSI 32 21 66%
6720 GVI-28-FLA GVILSNGLSLMGFYRVFERAVSVLGNVSLSLFLA 32 12 38%
6721 AIS-25-LLS AISEALLSIVAASKINTIIINVLAIFPLLLS 41 7 17%
6722 AIS-26-LLP AISGAHHVHALAEHYGVPVILHTDHCAKKLLP 35 9 26%
6723 VSV-28-IVV VSVIIPAYNEEKFLKLAIASILEQEYPELEVIVV 30 10 33%
6724 GLF-24-AFL GLFLGIAPAIQMAGPGVLLGYAIAGFIAFL 31 16 52%
6725 LGY-27-IAG LGYRAFGAGAAAQVYFGKHYDGLSLWEMLPIAG 29 19 66%
6726 LSL-28-ILV LSLALLALALKFFQEILHVLPNIFSLAEMDLILV 47 10 21%
6727 LGI-29-ELG LGIGHLYASYYGLRKNGSRHGPDLIDPGFILPELG 41 14 34%
6728 LVG-24-VGI LVGLGLGGLYIAGLLLIAGLAPVALIAVGI 40 5 13%
6729 IAA-29-ELL IAAAGGAVALTYSVPSLLKLAFGYLAALAKAVELL 58 8 14%
6730 VIA-29-ISA VIAEVAKEQGVKPCRPLSLAVVAAQIAITASPISA 40 13 33%
6731 GAL-27-NLA GALGGEAASRQAAAGILAEYLRGWQVALDANLA 36 16 44%
6732 LVV-24-IGG LVVVNLYPFAETVPSGAALDGCIELIDIGG 49 8 16%
6733 GAG-27-IVL GAGGLQDVALHMLGLALALAHGAEHAQLLAIVL 38 6 16%
6734 AIV-26-GLL AIVWQSRQTADICAELKEAGYEETVREKTGLL 56 20 36%
6735 SGG-24-GVI SGGARIQEGVNSLVGYGEIFTRNIGASGVI 34 15 44%
6736 ALT-29-ASG ALTSHDEIVLAHGALKALAADLMKIANDIRWLASG 43 13 30%
6737 ALT-25-GIE ALTKEGVEKVLDDLKAMGFDFIVCDSPAGIE 31 17 55%
6738 GVV-25-GLS GVVGHLLARNNRGGGVDMVVSGGVPQGAGLS 45 9 20%
6739 VVS-25-ALL VVSALTAAGGILATLLALLTLLLLGGVLALL 55 10 18%
6740 VDL-24-VIG VDLAAANGGNIEVTNAGFSNTTSVAVKVIG 30 16 53%
6741 VID-27-IAS VIDANQRVVAYERYTNPGNNVRPELDSVERIAS 28 13 46%
6742 RLI-24-SVV RLIGAPPGYVGYEEGGQLTEAVRRKPYSVV 28 21 75%
6743 LTI-29-VGL LTIILPLIGFVLLAFSRGRWSENASAIVGLGSVGL 32 6 19%
6744 GSI-29-LAL GSIRSPIWRGGGVVFGPTPRSYGAALPQKVRRLAL 44 13 30%
6745 LLA-25-GIT LLAGAGMISAELAGEQLVLDFDEQEQARGIT 48 12 25%
6746 ALI-29-AKL ALIKLLQKAAGVARFMVLANMKLSEQEGREKFAKL 38 7 18%
6747 DLL-26-LAI DLLLPAAMTKVAEEANLAAAEKHFLGAKYLAI 39 12 31%
6748 LGV-25-IVA LGVELPLEEVPLVQKRAIQLARENAKPVIVA 46 13 28%
6749 LLK-29-GFL LLKEVDKHIDAEEDLTPLICGVGLGGYWAERIGFL 32 11 34%
6750 LEA-25-SVL LEALLSAQQALYISYVGRSIQDNSERFPSVL 37 15 41%
6751 VIG-25-TIA VIGVGGGAALDTAKALARGIGIAFVAIPTIA 31 9 29%
6752 AIV-25-LLD AIVGAGGAGKSGLIALLKRLYHVIDGSILLD 38 17 45%
6753 GVI-25-SLA GVIGHLKSGKKDIADCLLYALGRTGNVRSLA 37 6 16%
6754 VLT-28-ALS VLTVLHAGGKFDKDSYKVSGGLHGVGVSVVNALS 46 21 46%
6755 ADL-26-AGI ADLATSDCDPYLSEFITGERGGEDFLVNNAGI 44 13 30%
6756 ALN-26-SGV ALNIPGHHPARADHDTFWFDATRLLRTQTSGV 30 17 57%
6757 EIV-25-EGL EIVKPQRQLPTTMEFVDIAGLVAGASKGEGL 32 14 44%
6758 AIT-24-LVG AITAKEMGSNLLNGFSIRKYTVAAASLLVG 37 6 16%
6759 LLD-28-LSA LLDFAASARLAVGEALTNIAATQIGDIKRIKLSA 54 15 28%
6760 GLG-27-LIA GLGGGNDEREQTLNQLLVEMDGFLANEGVILIA 52 15 29%
6761 GVL-28-AGI GVLIGIGMAQATAILLFVTVGLLPVGELIMFAGI 47 17 36%
6763 GGG-29-LEL GGGSTITARLAKRGKLLQRQRVERLLDEGFLFLEL 33 18 55%
6764 GIG-24-ALV GIGPKTAVRLAFAVLDMKEDDVLGFAKALV 50 11 22%
6765 GIA-27-LDG GIAMPHAKNAAVKEPAVLFAKSNKGVDYEALDG 33 19 58%
6766 LPL-28-ALT LPLLYFESRPVGLLIARARELETIRLFLTGLALT 54 11 20%
6767 LPL-29-VVS LPLSESPFISKELGTRHRAAIGISEVSDALTIVVS 37 18 49%
6768 GSG-27-VIL GSGPIVIGQAAEFDYSGTQACLALKEEGYRVIL 30 26 87%
6769 AIG-24-LGI AIGAAIQGGVLTGDVKDVLLLDVTPLSLGI 48 29 60%
6770 VLD-29-AKL VLDGDNIRHGLNKDLGFEADDREENIREIGEVAKL 34 8 24%
6771 ALT-29-ALT ALTATQVLGLAATQLAALSTTDIAALALAQVGALT 54 11 20%
6772 IGG-24-LVL IGGDGWAYDIGFGGLDHVLALGENVNILVL 49 12 24%
6773 GID-25-DAL GIDTAHHAQAVMAAGFPARMVKAVRDAIDAL 41 11 27%
6774 LVF-25-GFL LVFTIAASANIPLLYLGVPMAAALSVTHGFL 28 12 43%
6775 YGL-26-NAL YGLPTLVTNCSNNYGPYHFPEKLIPLMILNAL 26 23 88%
6776 ALI-24-ELL ALIAAERETGLDEPIETGDPLDADISIELL 49 12 24%
6777 TLL-25-LLK TLLHPLLLTFPAGKLTGLIGHNGLGKSTLLK 50 9 18%
6778 DLL-25-LIE DLLATGGTYEATIELVEELGGIVAGCAFLIE 52 12 23%
6779 LGA-26-EAI LGADSHVAVSFESPEYTADVDAMGTLRLLEAI 41 13 32%
6780 LGG-28-LID LGGRAMEIVYDEEELERYMTEAVKVSPEHPVLID 36 21 58%
6781 AIS-26-AGL AISPWPGAATGSGGEIRDEGATGRGAKPKAGL 45 15 33%
6782 AFL-24-GLI AFLAKLSAILSRLTPLDWSDLYLPFILGLI 40 6 15%
6783 LDI-25-ALA LDIPVIRGVCPDTLAETSSPASDEEPGDALA 49 18 37%
6784 PLL-28-LTL PLLLMGGLVGRLFREFAVTLSVAILISALVSLTL 58 25 43%
6785 LDV-28-GVI LDVTIQAQILDLLKDLQKEFGTAVLFITHDLGVI 30 22 73%
6786 LSL-26-AKL LSLLLRRPPGREAYPGDVFYLHSRLLERAAKL 43 17 40%
6787 LLD-26-GFL LLDLIKRKALKLDHVETLVLDEADEMLDMGFL 31 23 74%
6788 ALS-28-LVD ALSDVDVLVESERLVLVDSLNDVLALFESLSLVD 39 18 46%
6789 ILA-25-LFG ILALALLFLGPALGLNAGLLLLATVLIRLFG 39 4 10%
6790 AIL-24-VSG AILDADLEGFLRSLTSLIQTILAAARAVSG 35 9 26%
6791 SAL-29-ASL SALMQALVIYVLTHDSIGLGEDGPTHQPVEHLASL 54 12 22%
6792 LLK-29-IAD LLKLGRAPVLALFSHQRVELNAYASQISLAALIAD 34 6 18%
6793 GLA-28-EIL GLASALDLQPALLLLGELERIRDIPSLLRDDEIL 44 2 5%
6794 GLV-29-VLV GLVDPKIIVLPAKGQVDDLLHEIRGRLLALERVLV 53 15 28%
6796 GIG-27-LLS GIGGAHFSLTLGPDELAAFIYDVLALEGSLLLS 47 12 26%
6797 DVL-25-GLI DVLKVEHIIICGHYGCGGVIAAIGNPELGLI 36 13 36%
6798 SLV-25-IAT SLVRCQHGGKVKEFYQRLYLKKGAKKSIIAT 31 19 61%
6799 ELI-29-LSA ELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSA 36 13 36%
6800 FLL-24-ISG FLLAPDWALFPLLIIAALATVIASQAVISG 32 8 25%
6801 LFG-24-AFL LFGTPKRVAMGMGQEDVSALREVGKLLAFL 34 11 32%
6802 IVV-27-LVI IVVVDTIPIELKMSYLVIGLFEYLLAANLLLVI 40 7 18%
6803 DAI-24-NLL DAIAQLEEVHEQLTFLNSQGTDLLEAKNLL 32 7 22%
6804 LDV-25-LDA LDVAGAATLDLIDGAIRAAARLTGDAEGLDA 38 2 5%
6805 LDI-25-DLL LDISAVPILKKETHLPVIVDVTHSTGRRDLL 34 11 32%
6806 ITA-29-LVA ITAVVGVAKMGIDGDALSVKGLEPLGGDARGILVA 39 11 28%
6807 LLD-28-LVS LLDEPFTGVDEKTEAGIALLLRALRAEGNTVLVS 44 16 36%
6808 ILA-24-DAL ILADAYFASLLGGEGVSSNKAAIGLAEDAL 44 6 14%
6809 LGV-28-ASG LGVCGKLVLGASAAALGIGHLTAAFGLAVGAASG 44 14 32%
6811 VLV-26-IAL VLVRYRFAGKMQVDAKVDLPFALPTAVAGIAL 50 13 26%
6812 LIV-29-ALK LIVDDVNIDAILLFTALNIIGIPNCSAANGVVALK 34 7 21%
6813 GIL-28-ATL GILGYVVRWIDQGVGCSKVPDINNVGLMEDRATL 38 12 32%
6814 LID-27-ALL LIDAPHLYGRPGSPYHDTNRNAYRDNVLRFALL 50 9 18%
6815 DVL-28-LGA DVLAQIILYRAETAILALASGELLIAVALAALGA 45 5 11%
6816 LLN-28-LSA LLNLPAEARQSMVRAIIALGAAGLIVEQGTDLSA 38 6 16%
6817 LLN-28-IGA LLNLGFFGNLVIVIQLALSAELFLILVSLGLIGA 31 1 3%
6818 LVI-25-GLG LVIAGFPATFISIFFTGSLLIEVMFSLAGLG 42 11 26%
6819 PLL-25-GFL PLLAQLKQQLHSQTPRAEGVVKATEKGFGFL 35 15 43%
6820 LGF-24-ALI LGFDLESSKPPRGDFSGGDRDRAILAQALI 41 14 34%
6821 ALN-26-GAG ALNAETLAELAAAIDIIAADDDVGAVILTGAG 38 9 24%
6822 IVD-29-VLD IVDTLGAKLIDRLLDDLVYTIRLIPELAESLEVLD 29 6 21%
6823 LLG-27-IAV LLGVGVVAGAGLLLTKAAALGSAFALLGALIAV 60 7 12%
6824 LTL-29-DIL LTLVPYIAAAGEVKTKPTQHSVKELLSIGIQPDIL 36 22 61%
6825 EIA-27-ALN EIAEKTGSDGIAHGCTGKGNDQVRFEVAIAALN 30 9 30%
6826 VEL-27-LLP VELAATAAKHVILARLPEQEHEAALGSFASLLP 33 6 18%
6827 DIV-29-NAL DIVYEDDDIIVINKPRDLVVHPGAGNPDGTVLNAL 27 13 48%
6828 ILA-24-ALE ILASAGAPGIGEEKEVLAGIAAKSAIAALE 49 3 6%
6829 LIG-27-LVE LIGGGATAILLLTILGTLEVVITLKAAIALLVE 40 3 8%
6830 AGL-26-VAI AGLAIGGYKPIVAIYSTFLQRAYDQVAHDVAI 50 12 24%
6831 VLE-29-VLE VLERRQRDAENRSQGNVLERRQRDAENKSQGNVLE 46 15 33%
6832 VIG-29-AIL VIGGLVAKYGLSGGDRVLGPCAGALRGVFFVAAIL 43 6 14%
6833 TLG-27-GAL TLGMRVGFAAIGAGILQILAGFVPMAYALLGAL 49 10 20%
6834 TLL-29-ALN TLLADIAGLLDDVAILKKVAAKKTAGVLGDDLALN 37 7 19%
6835 LAE-27-SLA LAEQLIEQTGDNTLTLMDKGYYSLGLLNGWSLA 56 18 32%
6836 LEL-25-LLP LELALACHVRVCLDDDKTVLGLPEVQLGLLP 40 9 23%
6837 AGI-24-FLA AGIHMALATRLHVDPSHIGELVGPLALFLA 37 6 16%
6838 AAI-28-EAI AAIVERRGDEFSAISADEAGKDLSEALADTAEAI 40 10 25%
6839 LVV-24-TLI LVVIDAFFAGLEGILDFFQFFQPLVACTLI 34 10 29%
6840 GAG-28-GVL GAGAGAEERAAALVGAGVDVLLIDSSHGHSEGVL 58 12 21%
6841 ALT-28-GFL ALTFLFGAGFIGMEIYELHHLIGNGMGPDRSGFL 33 7 21%
6842 ELI-29-NAL ELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNAL 30 19 63%
6843 IAV-27-LLI IAVTKLKAGVLKTLLASMLAPALFTGFLLALLI 41 7 17%
6844 VSG-25-SAL VSGGQKQRLAIARALVADPEIYIFDESTSAL 41 18 44%
6845 IGV-27-LLV IGVVARIAGATVLTMALSLFEGAALMIAPALLV 42 6 14%
6846 IEL-24-RIL IELIGVTAGETSDPESTLPKAINIIPGRIL 30 11 37%
6847 VGI-25-SLG VGINGTKNDYQTAARASVTNPYFTVDGVSLG 32 8 25%
6848 SGV-27-ASG SGVRLELVELLLAMLNAGVIPVIPEQGSVGASG 37 19 51%
6849 LGT-24-LLL LGTLLLLAALGVALIALILLVALLGLTLLL 57 3 5%
6850 YLL-24-GLS YLLPLKGILSMHCSANVGEKGDVALFFGLS 34 17 50%
6851 VLN-28-ASG VLNMMNQDGVRNGYDLAQLKKVREVCKVPLIASG 28 21 75%
6852 LLA-27-TLI LLAQLPLADLYAGLGSVFLNALDPLEVPLETLI 55 3 5%
6853 ALA-26-GIS ALAAQFIKAGIVRELSITRTLGGDGLAGIGIS 55 8 15%
6854 LAA-28-VGI LAALAALLEAAITTGQQGRAGLAGPGLKVGIVGI 58 7 12%
6855 LLS-26-GLF LLSHIGMKDADKQEYTGARNARFSIFPLSGLF 44 10 23%
6856 GLG-28-TGL GLGEIETTATRPVETLAPGVMQRKVVAEGLQTGL 45 9 20%
6857 VVL-27-ADL VVLACSGGEDTSLILKVLAAKILAEAVTFTADL 44 8 18%
6858 VIA-27-VLL VIAGLLGKGGGAKTIRGVSAASLLLLTGFLVLL 51 4 8%
6859 SVL-26-VIA SVLIGAIAAGAGLLHVGAFILMLANAFPLVIA 43 13 30%
6860 KLA-27-LIG KLAAELEFTGSSLLALGAGALVDILVNAAELIG 34 4 12%
6861 IGG-29-GIT IGGGASAEVMAAALDVVLSDPNVKSVFVNVFGGIT 30 16 53%
6862 GVV-29-LDG GVVPELASRAHVRALLLLIRLALKEAGLLIDDLDG 36 9 25%
6863 VLT-28-LVD VLTVLPVPPVKVRPSIILETGKAIEDDLTHKLVD 36 13 36%
6864 GGI-28-IGL GGIGNIRAGHVQKGEIILGATLILLGGPAMNIGL 37 10 27%
6865 LGS-26-GSI LGSMFAGTDEAPGETEIGQGRKFKTYRGMGSI 31 11 35%
6866 TLG-26-AVL TLGGMIGGDGSGQGTLPYGKGGDLHLIVSAVL 50 14 28%
6867 ITA-25-ALK ITANFREGLNVLQYFISTHGARKGLADTALK 33 22 67%
6868 FLG-25-LGV FLGFIIAVLFGLGLANVAFASLLVLIIILGV 42 4 10%
6869 LNA-28-LLP LNAIRDAKPAAELENALVTLGGALRVAILGDLLP 33 5 15%
6870 LGL-24-ISA LGLLAGAGGGLGTALAAFPQGGGKVLGISA 49 6 12%
6871 AIL-27-ILG AILSTAGALTLGFSASKLADAFLLLEQNLVILG 47 1 2%
6872 LGV-29-GFL LGVIFFGFGNGGQAIGFANGTGHGGFFAGGAKGFL 37 7 19%
6873 ASL-29-DLA ASLDASLEARLLAAAAAASLAQTTLMVGHQLEDLA 46 6 13%
6874 EVL-27-VIL EVLVIADSGATPDFVASDLLSQAEHGPDSQVIL 31 11 35%
6875 ILG-24-LFG ILGLLLFSQDDIKKLAKALSGGEKGRMLFG 37 7 19%
6876 VSL-28-LLP VSLGAAVGPLLGLTVQTYGASAMPLALFLDILLP 42 11 26%
6877 IVL-24-TLL IVLSLLLLSILDGQFVKIVGISGGGKSTLL 45 9 20%
6878 GAG-28-ALK GAGELLGEEQSGQIATIGFSLYMELLESAVAALK 48 17 35%
6879 VIL-26-AEI VILDAAEGGLDLALYLILLQGDLILDIPVAEI 29 5 17%
6880 AIG-28-TLG AIGAAIQGGVLGGEVKDVLLLDVTPLSLGIETLG 41 20 49%
6881 LLF-28-ALE LLFLRFDVGQLLLLGLPAILVTQSRLVEVVSALE 32 4 13%
6882 NLL-28-ALS NLLKPALALGALRCITAALAAELRTVFDKDLALS 43 7 16%
6883 GVG-25-LLS GVGKTAIVEGLALRIGKGEVPEALRGVALLS 41 11 27%
6884 GGS-29-LVG GGSAAAVAGGDAPTAAGSDAGGSARIPASGTGLVG 35 11 31%
6885 GAS-24-ILG GASPASGTDHLGPTAVIGSVGGLPEGAILG 37 7 19%
6886 LDV-28-ALV LDVTIQAQIIELLLELQQKENMALVLITHDLALV 39 14 36%
6887 IAT-24-SGI IATVVSVNPQVNPDIVAMIGASAALSLSGI 28 12 43%
6888 GSI-27-VIG GSIGGGGELGYALSAALGAILDNPDLGVASVIG 32 6 19%
6889 ALI-29-LAK ALIAYPRRNIADEVTAGGAGGQIDPTQIQVADLAK 45 7 16%
6890 ELV-24-ATL ELVDTMGCHLGLTTGGTGPARRDVTPDATL 36 9 25%
6891 VIL-27-IGV VILPQALRNILPALGNEFITIIKDSSLLIVIGV 35 19 54%
6892 GSL-29-ELA GSLVGLSTSDVQLLVRAVGIGLAKKAQLKLAVELA 43 12 28%
6893 VLD-27-VVL VLDEPLAAHDFVAGEEYTKADAALWAAGGNVVL 37 7 19%
6894 VSG-24-GVG VSGEGHITCGHCRNCRAGRTHLCRNTIGVG 38 15 39%
6895 VIV-26-SAI VIVNESGASVYSASELARLEFPDLTVEKRSAI 27 9 33%
6896 GID-27-AGI GIDNIIIEVDAPEIPIMDGSAAPFVYLLLDAGI 32 19 59%
6897 ALS-24-LGG ALSDLANAGLDEKILGNGYAAEGLAILLGG 55 11 20%
6898 LSA-28-LDV LSAGDGGRRALPSLDAYARSIGLAFQVLDAALDV 41 6 15%
6899 GAL-25-ELL GALIAIERETGLQEYIETGIALDADISSELL 52 17 33%
6900 EIA-24-EVI EIAREYFPANYSAQGRPNIKDVLREGQEVI 31 12 39%
6901 ALT-24-GLG ALTFVSDSSHIEAVPTIKKGNSELHTFGLG 54 22 41%
6902 DLA-26-LAI DLAILKAVLEHLTTKIELYNLDKAIGKGDLAI 39 10 26%
6903 GAI-27-IVA GAILRYRLKEKTFSEGYTSTTNNRMELMAAIVA 39 7 18%
6904 DLI-25-LVE DLIDASSEQAARSALNSLQGAFSARVHHLVE 33 13 39%
6905 ADL-26-GIL ADLSKGQYGCVGQGLHIAKKLLPYIPNNAGIL 34 11 32%
6906 FGL-29-GEL FGLGLLLEIRAILKMISSYVGENKEFERQYLAGEL 29 10 34%
6907 VLN-28-GIS VLNGLKKFITNGLVADVAIVFAVTDPDAGSRGIS 26 14 54%
6908 NVL-27-GGG NVLRDYLTDLFPILELGTSAKMLSIVPLMAGGG 30 18 60%
6909 SLL-25-AIG SLLVGGVGIANIMLTSVAERTKEIGIRKAIG 56 15 27%
6910 EAL-27-LEV EALLILANIRALRAQARECTLEGLEEMLEKLEV 44 8 18%
6911 ALS-24-GVG ALSQIDNVTPALGQGYIIDSFLVVVAGGVG 49 9 18%
6912 ILL-29-GLG ILLLLAEKTGLVRILGAAVRGAILAWLFWQLLGLG 50 19 38%
6913 ALK-28-SLA ALKGIEKDFGKGAIMRLGERAEQKVSVMSSGSLA 43 15 35%
6914 LGA-25-KLA LGAICTRRCPFCDVAHGRPLAPDAEEPVKLA 39 13 33%
6915 LVA-26-GIT LVAFAAATGVMPLDMPESVLVRFKGKMQPGIT 36 19 53%
6916 LEL-25-ALG LELVQGALREFLTEADLTGEITPVFFGTALG 58 20 34%
6917 TLA-28-IAV TLASICAYLVALLILIPLALIYARTLAFILVIAV 41 10 24%
6918 ELG-28-PLL ELGGTDQKFNLLMGRELQKAYGQAPQVVLTMPLL 38 20 53%
6919 FLL-29-GVL FLLRPLLSLLSGLILCGLLLLFLFIAVGTIIVGVL 45 10 22%
6920 VIG-24-SVV VIGAISNQGAEADINRSEEMIDIHELFSVV 34 4 12%
6921 LIV-25-ELI LIVAPPKAGKTVLLKEIANSITANHPEAELI 32 13 41%
6922 GIL-25-LVD GILITPLPGATDLKPGSATRPFFGVQPALVD 32 14 44%
6923 GEI-29-LVV GEILIAINENVRGKDLFIIQKSCAFANDNLDELVV 30 6 20%
6924 LGY-25-AIV LGYSLNSPNPVSLKAAVDKLYGGTPLVKAIV 33 8 24%
6925 LLL-27-ISA LLLVATLLSVAGLVLLITLLALLSVLLAAAISA 56 5 9%
6926 IAG-29-IAA IAGLLVGGLGTGGAARALLAADGAGLAGELLIIAA 55 11 20%
6927 ATL-24-GIT ATLRNARGTKYPDPVQAAFIAEEAGADGIT 33 18 55%
6928 GID-29-GIG GIDTIVFNVGANYVDMILLAGVRLEDPTLFFIGIG 32 19 59%
6929 DVI-29-LLG DVILIDGGKGQLAQAKLVLAELDVPWDKLLPLLLG 37 6 16%
6930 LLS-24-VSV LLSNAIKIALAKGRIDVEIMGLADGLTVSV 42 4 10%
6931 ALI-29-LDA ALIDAGVRSLGLEGRLATFCYVILIGAPTRLQLDA 43 12 28%
6932 ILA-28-LGV ILAALELGAALLGTGTAYTPSLDILLASLAALGV 55 13 24%
6933 LLK-28-LGL LLKRRGFSPRVRALTTGLDVLGLSLLVIGEALGL 49 6 12%
6934 GVL-25-TLG GVLPIIVGLATRVAEYLTIVGKLYEGEVTLG 51 13 25%
6935 GAG-27-LEL GAGPIGAIAAAVAKHVGARDVVITDVNEKRLEL 40 12 30%
6936 AIT-27-GLG AITTRMDPARDTVLVENTPIDYLDFASPVSGLG 34 12 35%
6937 DLL-29-AGL DLLAFRAFFDLALMIGMIAFLFGAFGFGMGNVAGL 53 8 15%
6938 ILL-27-GLF ILLLVLLAVVLLLVVVTIGALMPFGERRLLGLF 40 6 15%
6939 LVA-29-SLV LVAGLGSLLMGLWANLPLAIGCAISLTAFTAFSLV 46 12 26%
6940 IAA-26-LEL IAAGARDLLADGADGQFRNDLAYRLNVEPLEL 44 6 14%
6941 ELV-28-LVA ELVAERLAEALRKLEAKTLALRYALAGLLSELVA 48 4 8%
6942 VLD-29-ELL VLDAYGRRSQVLAKLRRLLDLEIQEELVSAFLELL 46 9 20%
6943 ELI-29-AIL ELIGDDVADILAILQLLKTLDVTENKGTLGANAIL 35 8 23%
6944 AKL-26-NAL AKLSMENNNFLILDEPTNHLDIDSKEVLENAL 32 19 59%
6945 LFG-24-GLG LFGSASLAALNIPDMLALIGARALTGLGLG 46 4 9%
6946 SAI-28-ELG SAIALGVATPFAADVFIAHFGLAGVTAAKLRELG 30 6 20%
6947 GID-28-LID GIDERGILTESDEEWSIGDYVLSGGELPALLLID 31 14 45%
6948 LDI-26-LLE LDIDEDFAQVLVEEGFSTLEELAYVPMKELLE 40 9 23%
6949 FLG-29-AIG FLGLPVAAVPEHYASKVLALFLALPTIGRGDAAIG 35 8 23%
6950 DVI-27-IGV DVIKSAGERISSGDLENIAEAHPAVAEAAVIGV 27 10 37%
6951 GLF-24-GLI GLFSNEAGMGSAPNAAATAAVAHPVKQGLI 37 10 27%
6952 ILV-26-LAL ILVANPVLLLAFELSSMGLAVDAILLLPQLAL 55 8 15%
6953 ELL-28-AIV ELLVDLPLPVDQPVEEGCGKCLACMTSCPTGAIV 42 11 26%
6954 EAL-25-AKL EALRKALNKVTEKRVHIGIAELAAAELDAKL 46 7 15%
6956 ALG-27-LVF ALGMSKKATLAILLPYALKRALSSYSNEVVLVF 38 12 32%
6957 DLL-25-GGI DLLAEAFAHLREAAARNLGALPFEAAVAGGI 33 14 42%
6958 VLA-24-FGL VLAATAALHGPLEVLLTITEEAGMLAAFGL 49 9 18%
6959 GLG-24-GVI GLGGGHDEREQTLNQLLVEMDGFEGNEGVI 40 15 38%
6960 LAK-28-IGA LAKYMRVLTPEFVARFPNKIINIHHSFLPAFIGA 38 16 42%
6961 IGL-26-VLV IGLLLGAILGFNFGILAFLAEAELVGVDSVLV 45 10 22%
6962 GVL-26-LDG GVLGFPASAVNDAATKLLLDNRYGTGQSTLDG 38 6 16%
6963 LIE-29-IAL LIEANEAFAAQALAVGKDLGFDESKVNVNGGAIAL 39 26 67%
6964 RLL-29-GIV RLLETERPLRLDDARLLHDDISLTITAELTGAGIV 38 12 32%
6965 LVV-27-GVS LVVFANAVEDNPFMAGAFHGVGEADCVINVGVS 35 13 37%
6966 ILV-26-VLF ILVAGAPLGIDLFEIGQIVGPQLTFILIIVLF 31 7 23%
6967 GVV-29-VEL GVVGLGIGTRPDCLPDDVVEYLAELLERTYLWVEL 33 12 36%
6968 IDL-29-AGI IDLPAADPERVRTEVEDVIGLDASEAVLASAKAGI 30 14 47%
6969 IGV-25-SLL IGVMLWGKILELGTSDDVYNNPIHPYTGSLL 46 11 24%
6970 IGV-28-GID IGVAKVAKKYHKPVIAIAGSLTDDVEVVHQHGID 28 18 64%
6971 ITL-28-ALV ITLAKLQFLKQRAATAGRLEELEIWGLTLERALV 37 7 19%
6972 ISA-27-VVI ISALGKKDHALLIDCRSLGTKAVSMPKGVAVVI 27 10 37%
6973 RLI-29-GSG RLITEDKIRPDGRKVDEIRPLDSEVGFLPRTHGSG 31 19 61%
6974 LDG-24-ALV LDGILRLRRGAADAGALADIALKFEFDALV 42 7 17%
6975 TIA-28-LLL TIAEYTIEEGYDVLDAIDRLSKHALAYRLGSLLL 44 15 34%
6976 LLI-24-DIV LLIFDEVQTGNGRTGSFFAFEIAGVTPDIV 31 16 52%
6977 ALS-29-YLL ALSKLIECRRPPKGLVFHSLRGAAYALLEVGRYLL 37 6 16%
6978 VLS-29-IDL VLSTNGDTHLGGDDFDNAIINWLIAEFKKEEGIDL 33 13 39%
6979 TLA-25-SIA TLAAALMQIGGGSAFALMVPVLAGYIAFSIA 38 15 39%
6980 VLD-28-ALG VLDAERTLYDALQRLANARYDRLINLVLLYKALG 57 15 26%
6981 ATL-26-IVG ATLTAGYLAKAYKGRSVVEDVSLTVNSGEIVG 34 10 29%
6982 VVI-29-EIV VVIGPCSIHDPVAAKEYATRLLALREELQDELEIV 28 14 50%
6983 SIA-26-LTI SIASDLVERFMDLISALKLYRNAVPTQSILTI 30 6 20%
6984 YLL-27-DLA YLLLSVILLSSLSAMLLQLMSAKLGIVTGLDLA 30 10 33%
6985 IPL-24-GFL IPLVDRNQGGELLARIKGVRKKLSQDVGFL 29 11 38%
6986 GSI-25-TLG GSILGDKTRMLGLLVGPDAAIRPSPSLGTLG 30 8 27%
6987 VLA-24-IVS VLAGLGLGAFTSEAFTHLLEALTGQYPIVS 39 7 18%
6988 AVL-26-IVL AVLSRLLAIALVSEVAKEILGYFDLDAASIVL 50 6 12%
6989 LAE-29-AFL LAEQALTHLVVGLKASSNERAGAGLANRMGAAAFL 45 14 31%
6990 AGI-29-DAL AGIMVTAAHAPAPFNGYKGVGQDGGRLPPADADAL 51 9 18%
6991 AGI-24-VVI AGIVGAIPTGSGAALAGVGLELDAIAFVVI 38 12 32%
6992 LVE-25-AKL LVEKASLAAAEDLEAALDTVIVLAEDGGAKL 34 5 15%
6993 LIE-26-ASL LIEKQLIGYILRLRAIVGRITGMRDLAKRASL 37 15 41%
6994 DAL-28-LSL DALREELALLELGLREIGLAPLLLLKAGTLILSL 49 5 10%
6995 LSV-25-GLG LSVIGLGLAIAKAIALGVLALLGVLLLGGLG 44 4 9%
6996 IAV-28-ILD IAVASGKGGVGKSTTAVNLALALAAEGAKVGILD 29 17 59%
6997 DLI-28-LLN DLIILFTKAMQLIIMLQDIKGEIGKETKVLCLLN 30 8 27%
6998 ADL-25-LEL ADLVLDLVRLRAARAGKRIPLTAKEDALLEL 41 8 20%
6999 VVI-25-LDA VVIHDESVDRTTNGIGLVRVFTAEILKVLDA 34 11 32%
7000 LDG-27-TIA LDGADLDDYSLDALRAHIGYVPQDVELFNGTIA 28 15 54%
7001 DVI-29-LSG DVINAAKPAIAHDGISGVLLGKEIDLGNRVQNLSG 31 9 29%
7002 VLN-27-IAS VLNMMNQDGVRNGYDLEQLKKVREVCKVPLIAS 26 19 73%
7003 LGL-29-LVI LGLIIVVGIDSMSLLTTWLEMNEEIAILALLPLVI 57 11 19%
7004 LLA-26-VFL LLALLAAGPAGLLFIRSVDEILHFSELGVVFL 48 6 13%
7005 AIA-25-LVI AIALLVPIIPVLVSRLSNKINLNRLFLGLVI 52 6 12%
7006 AGL-26-GLF AGLEPLTLAAKEGLALLNGTQASTALALRGLF 46 15 33%
7007 GLA-26-GIS GLADGAVVGAISSLADTVAPALIIHLAKPGIS 41 5 12%
7008 VSL-26-GLI VSLFIYGGFTAFLLGMTGRGKSALSVGLAGLI 39 11 28%
7009 LSV-29-ISA LSVGIEVYKLGVLATPGVSYLVRTEKASAGVMISA 31 11 35%
7010 LID-25-EIA LIDCHTHLVFGGNRALEFEMRLAGVTYAEIA 32 10 31%
7011 EIA-24-GSG EIAINSAEAERLNVVPPKGARLSLSLQGSG 34 8 24%
7012 ALT-25-LLN ALTIFTRLVLESLLEVVSQSLAVSGLAALLN 37 4 11%
7013 ELI-27-SIA ELIAKAQKILAGLPAGQKAIAKQVSGARASSIA 29 4 14%
7014 IGV-26-VLL IGVAGAGRLLSAISIFTSGVFVEGAGLVAVLL 47 6 13%
7015 ISG-29-IAA ISGGLAGLAGGILISRLGSAQPTAGAGYELDAIAA 40 17 43%
7016 IEL-27-LIG IELKDISKSFGNRKLLSKLNLTVEKGEIYALIG 31 10 32%
7017 LFG-29-LAK LFGKGSGLINDKRAGGAVRDLGTGAARGAADFLAK 34 11 32%
7018 DAI-27-ILG DAIVRLTKTAICGTDLHIIRGDVPGCKSGTILG 28 10 36%
7019 LDI-26-GAI LDINDLGLPAATEFLDMITPQYLADLMSWGAI 30 11 37%
7020 GDL-28-IVG GDLTARMDGQFHGVFAQMRDDANATAEQLADIVG 30 15 50%
7021 RLL-29-LVD RLLANTHLHKELLAVYPWHASFILAADTMPIVLVD 41 11 27%
7023 IGA-28-AAI IGALIGTGVFAIAAAAAGIAAGLALALAAVLAAI 55 7 13%
7024 IVA-26-LIG IVAGTTLGAGMLAVPIAAAGVGLSVSLGLLIG 45 6 13%
7025 GKL-28-LLS GKLLVASKGVVKEFAATLKEEQPKEQVLMDVLLS 41 4 10%
7026 VVI-26-LIG VVIVAGETGSGKATQLPKICMELGRGIGGLIG 35 11 31%
7027 LAL-27-VLE LALNDGFNAPELGDSILKDLFLGLDIDSAVVLE 53 11 21%
7028 LLA-27-ALN LLATAGAVGIPLELLAFIAGVDRILDMARTALN 53 10 19%
7029 ILA-24-ILA ILAGPLGALAPLISVLIASGGLLGLSLILA 57 10 18%
7030 GLA-26-AIL GLALSSLALFAGSLAEITGLQGPVGRIAGAIL 55 4 7%
7031 VLE-29-GGS VLESSGLPGKLADCSSEDGEELEIYIVEGDSAGGS 30 8 27%
7032 ILV-28-VLN ILVANGWMQNPIAADFAFETMRMEMVSFLELVLN 32 10 31%
7033 DIV-28-IVA DIVVLVVAADDGVMPQTIEAIQHAKAAGVPLIVA 29 18 62%
7034 ELL-29-AIS ELLVAMGPTAVIIAGAVGLGVARGLDVGILVTAIS 37 6 16%
7035 GLL-24-LDA GLLAGLAGIILYVRLVSALPDAGVGYELDA 53 13 25%
7036 LLV-28-LID LLVNGSSGIAVGMATNIPPHNLGEVIDGCIALID 37 16 43%
7037 IAL-24-EIA IALAAGIADGLGLGDNYDAALITRGLEEIA 38 7 18%
7038 LLI-27-LGG LLISFWLFLCLAIYGALASLLITVFGGLSLLGG 50 15 30%
7039 LIG-29-ILV LIGLLLILLVVVKFFLLVQSIITIIALVALGSILV 41 2 5%
7040 LAK-25-ALK LAKELLALTLLTLKYLELVNRDTELVEAALK 45 12 27%
7042 IVL-27-LSL IVLGIDNLVFIAILADKLPPLRRDKAELLGLSL 50 8 16%
7043 KLA-24-EAL KLAEGLKAADMAVKVGSGLFMPTIALSEAL 50 6 12%
7044 IGA-25-LSG IGAYVDEGTMVDTWATVGSCAQIGKNVHLSG 49 19 39%
7045 PLL-28-SGL PLLSGARASGEGGRFVFLTPHYIALGLAASDSGL 45 12 27%
7046 IAS-26-ASG IASALLLGSLLRRGNKVTLYCADALPAEGASG 36 17 47%
7047 ATL-26-SVL ATLLHDDVVDESDLRRGKATANAAFGNAASVL 45 26 58%
7048 GLD-26-AIL GLDSLPPAILFYRQMLQWFGGMGIIVLAVAIL 37 16 43%
7049 AEI-28-VLA AEIAVAFIIALDDLGIGRALVGKNAVDGVGAVLA 39 5 13%
7050 EVI-24-VGL EVIAGKKHYFDPKVIPSIAYTDPEVAWVGL 32 12 38%
7051 YLL-24-GLA YLLGGQFLGLAPGECVAVEDAPAGMLAGLA 37 7 19%
7052 LGL-28-FLG LGLNYKGVVNIGLALVSIGTALVVVTVGGIPFLG 48 13 27%
7053 AIA-24-EAI AIARALAKEPGILLADETTAALDLGTTEAI 43 8 19%
7054 LAK-26-ITA LAKACIAGRDNGELVDALDDIETDADLSIITA 32 12 38%
7055 GLS-26-VEL GLSLIFIAHDLAVVKHISDRVLVMYLGHAVEL 40 14 35%
7056 LEL-26-AIV LELAGKKAAGTAAGATLLFGLLGGSVEASAIV 33 6 18%
7058 VGL-27-GAG VGLSLELATLLLLGIARKVVGTKDETTIVDGAG 53 14 26%
7059 GGG-27-EIL GGGLLTDDVAGAGTIAGLKIDKSAGDEDDKEIL 35 4 11%
7060 LTG-29-ELG LTGRLAEEYKPEYWVRHVREAVRFADGIITLSELG 42 9 21%
7061 AKL-29-LVE AKLVGAPFVKVEATKFTEVGYVGRDVESIVRDLVE 36 15 42%
7062 LVD-24-IAL LVDFKRNKIGVIADVERLEYDPLRGAKIAL 41 8 20%
7063 GIS-27-LGA GISSGAAFGVVLILFLVPGGAAEILLLAGSLGA 39 8 21%
7064 VEL-28-TIA VELAFETMVDSGIIEESAYYESLHELPLIANTIA 30 12 40%
7065 VID-25-VLG VIDAPRAAYEVSDLELAIINLTMTNIRTVLG 34 11 32%
7066 VIE-27-IGV VIEEYVNIKGVPLKLVDTAGIRETDDIVEKIGV 27 17 63%
7067 LDG-29-TLI LDGYGYREEQQDNAILLAKTPVMDALWANRPHTLI 27 12 44%
7068 YLL-29-ALA YLLLFVGLLTGILGLPLVEFAGAPFLLAGIAAALA 50 8 16%
7069 NLA-29-LIA NLAQVERTAEQVAAIARGGYILKDSAGKPDIILIA 33 13 39%
7070 NLA-26-GLS NLALALAALGVRAGLLDADIYGPSVPADLGLS 34 8 24%
7071 YGL-27-ALA YGLPTLTTNCSNNYGPYHFPEKLIPLVILNALA 47 15 32%
7072 ASL-28-LVG ASLLAILLALFALGLLAALIAAALLALLASILVG 55 6 11%
7073 LVG-29-DAI LVGTFAGMFHLGFSLNALSLLALVLAIGEVVDDAI 38 14 37%
7074 LVD-27-EGL LVDDDPGLLKLLGLRLTSEGYSVVTAESGAEGL 32 7 22%
7075 GEL-28-VLF GELLALLGPSGSGKTTLLRIIAGLEHPDAGDVLF 27 12 44%
7076 GLF-27-DIL GLFAQQRKKPLPSPPRCVGVITSKTGAALRDIL 26 17 65%
7077 ALE-29-RIL ALEKRLGALLFQRRAGRVDLTDAGGAELEDARRIL 35 9 26%
7078 ILL-29-ISA ILLDVMMPDAAGAELGQLLIALFISLAIPAILISA 38 5 13%
7079 LTL-26-IPL LTLMATSKGIAGGPGVSDVVLLALLGSVDIPL 38 9 24%
7080 LAK-26-IAG LAKGGSEELYKKLASALFPGAQLGPGAAVIAG 39 7 18%
7081 LAI-25-IAV LAIVCAAIYLFAPNASVVLAMGLAIGQLIAV 43 6 14%
7082 LGA-29-IAT LGAEEFGFATAALVALGCIMMRVCHLNTCPVGIAT 39 25 64%
7083 LGG-25-LTG LGGGLVLSAKDGSRAILKAAALGGAGIALTG 51 8 16%
7084 LEA-24-DLI LEALLAVADETASLIITGNGDVVQPEDDLI 35 16 46%
7085 VLI-25-IAS VLIIGAGGVAIVVAHKCALNRDVLGIILIAS 35 6 17%
7086 VLD-24-AIL VLDPALLRPGRFDRKVLVGRPDVKGREAIL 35 18 51%
7087 IAT-27-LLV IATGSATGAATFAAGIVVPLGSKILGLNRELLV 37 13 35%
7088 ELL-27-GAL ELLRVGKYALAAGIRNELVVASAILATAELGAL 53 5 9%
7089 VLL-25-IPL VLLLPAASEVLPKDVSLKTRLTRKIGLNIPL 41 15 37%
7090 LLE-29-IVG LLEVKNLIAQEVIVFLTGGAVKKLTEEGLSTEIVG 36 8 22%
7091 LIA-24-GGI LIALHGGELMALALGTGVILLDEAAVAGGI 43 9 21%
7092 LLK-27-LLS LLKAENKTLDLVGLLQIDLELADFKEHILVLLS 57 5 9%
7093 GLG-26-AIE GLGEPNRPIGSFLFLGPTGLGKTQLSLQLAIE 35 8 23%
7094 SLA-25-ELL SLALALSLRAELEILDEPTSGLDPAAVEELL 53 7 13%
7095 LVG-24-GVS LVGAALALAGAVMQGLFRNPLADPGLLGVS 36 26 72%
7096 VIA-25-ADL VIAQKDLEIRGPGELLGTRQTGLAEFKIADL 50 15 30%
7097 LIE-27-AAI LIEANPGPGLGALLAGAFFGLAFSKLSAGGAAI 36 14 39%
7098 RLL-27-GFL RLLDLIKRKALKLDHVETLVLDEADEMLDMGFL 32 23 72%
7099 LPL-27-GVS LPLDDLLVLARTFLNPNLSRSALDRCLRRHGVS 39 13 33%
7100 EAI-25-ELG EAIRARATAIVLDETGAMGFLFLPKIIEELG 35 5 14%
7101 LLP-25-GIV LLPEAFALVREAAKRTFGLIGVIVQIALGIV 36 14 39%
7102 LVI-28-NAL LVIASFVIGPGATTLLMLIGLSVRLGVNPEINAL 37 8 22%
7103 GEL-29-GLA GELHLLVAATVDEVGVDVPGASLLIEENGEPLGLA 45 8 18%
7104 EGL-26-LDG EGLPELTTVAADKGYDSAENRQHLEEHALLDG 34 6 18%
7105 IGV-29-GVL IGVVLTSPAAILAALGMAIYQAHSGSLLKFAGGVL 44 12 27%
7106 LFG-27-ELA LFGEQAVLCGGLTALIKAGFETLVEAGYQPELA 34 19 56%
7107 VGI-24-LVL VGIIALAGLLLEAKMGIVAAEKLAGVGLVL 40 4 10%
7108 VID-28-GLD VIDASHAEGKWTGMCGELAGDERATLLLLGMGLD 28 20 71%
7109 GLF-24-GIV GLFCERIFGPTKDWECACGKYKRIRYKGIV 31 20 65%
7110 SLL-26-LEA SLLEAHITSILAAIVVTGYSRLEAFDARMLEA 48 8 17%
7111 LVL-24-LLN LVLNASEALTDQDRSLLEASQGLNRITLLN 45 10 22%
7112 TLL-28-VSL TLLIAQVLVVVVVTAFLQDWLASIIPLDAVPVSL 48 9 19%
7113 AIL-28-LLK AILEYLERSGGSLSGLAISLNQDLPLIRSQRLLK 50 10 20%
7114 LLT-24-GLF LLTLFRARYWMIANIPVSLRVAITSGIGLF 39 15 38%
7115 ALV-29-LGS ALVVKLIPPQLAGRFFTKLMPVVPGSAAIAALLGS 45 13 29%
7116 VLS-27-LIG VLSVAVANHYKRLRSALLSLGVEGGSSNILLIG 49 7 14%
7117 VLS-28-LDV VLSGGEQNRLNLALTLKQGGNLLLLDEPTNHLDV 35 21 60%
7118 AGI-29-VGL AGIYLAEYAKKGRLTNFIRTCIEILSSLPSIVVGL 46 24 52%
7119 LEA-25-GID LEAMAQATGILLFKSVGKLEPGELLYFAGID 33 8 24%
7120 LVS-26-EGL LVSEVASKTNDIAGDGTTTATVLTQAIVREGL 31 11 35%
7121 VLI-29-LVV VLIDTAGRLQIDEELMRELADVKALAQPNEILLVV 39 14 36%
7122 LTG-28-LGS LTGLPPSAALLASGLGTLLFLLITKGRIPAYLGS 38 12 32%
7123 GAG-25-KLA GAGKSTLFFGLAGQEQPDSGTIPIGLAVKLA 41 11 27%
7124 LLP-26-LAE LLPLLPAKAVAGVLAREVGVNDSYFTRLGLAE 54 7 13%
7125 VLT-28-ILL VLTAPGFLIENKGKFLILAIVKSVFRALPTIILL 43 7 16%
7126 VLT-28-GAS VLTLAAVHTLGIPVDLPTALLLSVVAALCACGAS 32 14 44%
7127 EGL-28-GAS EGLALRIVAGEVPEALANVELLSLDLGLLQAGAS 32 12 38%
7128 GLD-29-LAE GLDPVVARSGRIEVRKGIEKRGNKYLRSLAYALAE 50 8 16%
7129 LEV-25-TLL LEVLKGVSLDIEKGEFVVIIGPSGSGKSTLL 35 20 57%
7130 ALN-24-IGG ALNNIIAGEPGWLGTVVNAGGRLYARTIGG 29 15 52%
7131 SGV-25-GGS SGVLTSVHAFASDPARGMFILAFLVLVIGGS 31 19 61%
7132 ITA-25-VGI ITALGAGIAVALAAPDVGIDAPIPGFSVVGI 31 8 26%
7133 SVV-25-LGL SVVVPVTAAVGADIARLDAELLVELLVELGL 40 10 25%
7134 ALL-27-RLI ALLLASLPYRIYGGMRFFERQEIKDALSLLRLI 51 10 20%
7135 LLA-27-SGV LLAEGFLLLFDGFTIGSAALIQLALLLLALSGV 56 7 13%
7136 LLI-25-GAS LLIANEAALVIFNSGYFKEGFSCQTGTGGAS 41 15 37%
7137 AIL-28-NLA AILARFDSTDTQLRAREALGGVLGDKYVAALNLA 31 7 23%
7138 VLS-25-ILL VLSVAGYNHYKRLAHGAGLAAVSLAKSLILL 47 8 17%
7139 VLV-26-LIG VLVFIVAAPFGGELLLDEAAALRPLIAAGLIG 49 3 6%
7140 VIA-25-LLE VIARETIRALPKDVGAKCYGGDASRKRKLLE 57 15 26%
7141 LVS-26-LLF LVSVHAFLSDPARGMFILAFMVLVIGGSLLLF 38 9 24%
7142 IAG-27-DLV IAGINAALKFQGKPALILKRSDAYIGVLIDDLV 33 12 36%
7143 EIA-27-TLA EIASEFRYRKSAVRPNSLLITLSQSGETADTLA 38 16 42%
7144 IGG-29-ASG IGGGFTGLSAALHLAEAGADVVVLEALRAGWGASG 39 21 54%
7145 ISG-27-ALK ISGNAMKGIKNRMFSHGELAGNSYIASVNAALK 33 9 27%
7146 GEI-28-LFG GEIGLIMPYEKDFCATCNRLRVSITGKLHLCLFG 27 11 41%
7147 GIT-25-LVA GITDDMLKGAPPLDQVLKEFQEFCGDAILVA 37 18 49%
7148 GIE-24-GKL GIEARGFILGGALAYELSAGFVPVRKPGKL 30 13 43%
7149 NLA-26-LAT NLALAIILLDGGMRTRIASFRVALGPALSLAT 33 11 33%
7150 LLE-29-LEL LLEKLLRAEENVITAQTRLIAGAKARDLHTSLLEL 53 6 11%
7151 LVL-28-LTI LVLVGGPTGSGKSTTLAAMLDAINYIATPHILTI 39 10 26%
7152 LGI-27-GAG LGIKLENVTLDMLGRAKKVSISKENTTIVDGAG 45 17 38%
7153 LAS-28-LGT LASQIGAGLVGVMYVLDEPSIGLHQRDNERLLGT 38 12 32%
7154 LAI-29-SVL LAIRPAMREVFLALGIYLTLAGNGLAAYEAFDSVL 45 7 16%
7155 GLI-28-LTG GLIAAYVGGTAAPEGLRRAFVALLLGSGVDLLTG 42 11 26%
7156 GLA-27-GAS GLALRIAAGLVPDSLLGVELLALDLGALQAGAS 50 12 24%
7158 LLP-26-ILL LLPGLSPGASVALLAALEFELGLGPDGRGILL 57 11 19%
7159 LLP-27-LGT LLPTLGGQTGLNMAGFLMVFGLLAAAIVWLLGT 38 22 58%
7160 DLI-24-VLV DLIYKTIEGKFKAVLDAIKNRHDKGQPVLV 36 10 28%
7161 GVG-26-ATL GVGGAVVSINLPAVPNSVAKIESFWGGRAATL 37 6 16%
7162 GID-24-ILA GIDLAAFHRPKRFFGAARNIEEGGSLTILA 31 9 29%
7163 NLA-25-DVL NLALGASAMARRKVIVKKLNAIQNAGAMDVL 29 8 28%
7164 AIT-25-LGT AITGRATMAFSQAKDAAGLAFNLPAIVALGT 29 6 21%
7165 ELL-28-IAA ELLRALAAESALGLSLAGAACAAEGAAALALIAA 51 4 8%
7166 LLS-24-LDI LLSRTMNLGTVSEERRSVESYKFNGWELDI 37 10 27%
7167 LLE-27-LLT LLEEAKESVKAYKDCVSAAANEKEKKECEKLLT 49 12 24%
7168 ILA-29-SGL ILAFKGDVYTGLQAENFSEADFDFALQHLRMLSGL 45 9 20%
7169 VLA-26-LDI VLAKELALRLADIDSLEAVFGADLGEEKFLDI 36 6 17%
7170 AGI-29-LTG AGILSNMITGDHKLTALAIASEIFINPAGDDNLTG 45 14 31%
7171 VGL-25-LGF VGLGLSSKSLEEKREAYADDITYSTNEELGF 39 11 28%
7172 VIG-25-FGL VIGFGEAVAAADEALGFGLNIFDLDTIKFGL 34 6 18%
7173 KLA-29-LGV KLALERGVLDAALEQLDSGMSQTLEIALLARHLGV 46 15 33%
7174 GIA-25-SGG GIAHIYASFNNTIITITDITGAETIARTSGG 38 19 50%
7175 LPL-28-LPL LPLELALLPLALLAAALQLARELSGVGGQVLLPL 64 6 9%
7176 LLR-26-LIG LLRRGELEGKLGKTALLHHVPNELSELIQLIG 44 7 16%
7177 IVA-27-IGL IVAAITIAAGALAMPLAAAGVAFSLTGALLIGL 46 6 13%
7178 ILV-27-VAL ILVVAATDGIMPQTREHVLLARQVGVAAIVVAL 46 11 24%
7179 ILD-28-LVA ILDTAGRTGIDLELMIEMAKIAKLRNPHEIALVA 35 6 17%
7180 LEV-24-IGL LEVLQSPDNHHVSAEDLYKRLIDMGEEIGL 31 10 32%
7181 VLF-27-LGV VLFYLLSLVGVVPAEFFRTRFGGMIFGAGALGV 37 6 16%
7182 LLL-27-IVS LLLDELTNHLDLGAQEFLTGAALVSASAIVIVS 53 9 17%
7184 LAS-28-GEL LASTLEGNQLLRRVNMADISDELLVPIAVLRGEL 49 6 12%
7185 LSA-28-LVI LSAAILLAILLTIGAIILFMAALALLLELLSLVI 41 4 10%
7186 SLA-24-LLK SLATPVGEALDGPLSLAGKRIATSYPHLLK 43 10 23%
7187 SLA-28-DLA SLAALPDGLLADEATDALDPEAVGDVLNLMKDLA 45 9 20%
7188 VLS-27-GLS VLSVGDAAVGLALGANGETVGAGALIIAAGGLS 46 7 15%
7189 IGL-25-EIL IGLIKAVNTFNPEKKIKLATYAARCIENEIL 36 17 47%
7190 LVS-28-VIG LVSEPIKPIIGCVVMSNAVHAYISQSDKGDLVIG 37 11 30%
7191 RLL-29-VLD RLLALTTEKLAALLVAGAIALSPSDLRSKLVDVLD 47 1 2%
7192 LTG-25-GLV LTGLLTGLLLALLTGLGAAALLGVLPVVGLV 49 5 10%
7193 LDV-27-GLL LDVLAVALAMGDASDEALAVELADYSLAVLGLL 39 6 15%
7195 ALE-28-FGL ALELVVDRGNLDRAPWAMTSLKNSMKWDEERFGL 29 9 31%
7196 PLL-26-SAI PLLLNAGLLELAGAALLKVMRPLFKLPARSAI 31 5 16%
7197 LDA-24-VLI LDAIAAVVIGGTSLSGGRGRIVGTVIGVLI 32 14 44%
7198 SAI-28-ALA SAIDAAVEAAAKLEAPAIADGGLAGSGDLAKALA 54 8 15%
7199 IAT-25-GIT IATLRNARGTAYPDPVDAADIAEEAGADGIT 29 12 41%
7200 LGL-26-ALN LGLMAGADRVEGLLFGKGQLTGVPDLVLLALN 41 7 17%
7201 LGL-28-VID LGLPAGILLMLSETSIEGICLIAEKEGPKGMVID 36 13 36%
7202 LLI-28-GVS LLIHRPDPLMDADEVADAFDVLHLIGKVRHFGVS 38 17 45%
7203 ALE-26-EIA ALETALKGEDAAAIEAKAGELAQFSQKLREIA 41 6 15%
7204 LTL-26-EGL LTLLISKAYARGEGHGGPVIDRWWLLEVIEGL 39 9 23%
7205 SLA-29-AAI SLAVVAATYGGPLLGAALFTVRVLVGISRGAVAAI 55 12 22%
7206 GLA-26-IAT GLAGQVLGILVLLHTNNGIGGLLNIALAGIAT 39 6 15%
7207 AGI-29-LVI AGIKFPEDDLLGIDYVIPDYSYIVENLARVKALVI 38 8 21%
7208 SGL-26-LSL SGLLLGIEQAGVLGVHELGSLPLFSLGLSLSL 48 9 19%
7209 TLA-24-LDL TLALGHNGPVTVLAIRNVAASGLPLHNLDL 48 13 27%
7210 VLD-25-DAL VLDISVEREACPMHLAPTSSTLVVLLLGDAL 45 9 20%
7211 GIS-27-GLL GISFEIPEGEVLLLVGESGSGKSTLARILSGLL 49 16 33%
7212 VSG-25-LGL VSGIALAANAGDVVIASGTVLAALEGAFLGL 53 7 13%
7213 IGV-29-VIV IGVTGLVLESDALTTLGTSLGAQDVVALTGALVIV 29 10 34%
7214 VIV-24-ILG VIVTFSLVGALFIAGKGVKSARPVGAAILG 40 7 18%
7215 GLD-27-IEA GLDAVEEQDDVALGEALPSAIEDVESNDHAIEA 31 9 29%
7216 ALN-24-LLR ALNCVSLEVNFGELIALLGPSGCGKTTLLR 35 11 31%
7217 IAD-29-GVL IADTPGHEQYIFNMGTGASTCDLAIALIDAAKGVL 32 10 31%
7218 ALA-25-VIE ALALVAVLALLGSLVRLDILLLAPIQREVIE 48 8 17%
7219 GLS-26-ASL GLSGGQRQRLALARALLALLGLALLDEPTASL 52 11 21%
7220 LVA-24-ISG LVAFASSLDQIGPITRLVEDNAILLEAISG 40 12 30%
7221 AAI-29-VIG AAIAGLIVAAAIRLADALAAGLELELDAILAVVIG 46 8 17%
7222 VLE-27-LVE VLEEVIAEHPVLLNRAPTLHRLGIQAFEPTLVE 42 26 62%
7223 GIA-27-IPL GIAIGLIAGLWVNALLLFATLFTRGFTARDIPL 31 4 13%
7224 DVL-25-TLL DVLFSNINLAVIELLRIALVGRNGAGPSTLL 39 8 21%
7225 GVV-27-IVV GVVLVVDAYEGTMPQTRFVLKKALEQNLIPIVV 32 12 38%
7226 VAI-24-IEA VAIGMVAWLDMARIVRGQTLSLKRKEFIEA 31 10 32%
7227 LDA-25-IAG LDATAGEAVIADEPLLELAALEAPEELGIAG 39 8 21%
7228 ISA-25-SGL ISAHLALGLVCEGDVIFHKTENSYVYAESGL 33 6 18%
7229 IEL-26-ELL IELAQQQGFTYTRPFDHPAVIAGQATLALELL 38 7 18%
7230 NLA-24-ELI NLARSLQGKSLKLIGLAFPNIGNIFYAELI 27 9 33%
7231 VVL-29-EVI VVLPAGFPNLLVNGSVGISAGMATNIPPHNLGEVI 32 10 31%
7232 NLL-28-FLA NLLGGGIRLGPSTAGHPFGKLRLLYECNPMAFLA 29 8 28%
7233 IAV-25-ILV IAVGADVSDAAAVAALVARIADVFGLVDILV 36 9 25%
7234 GLD-25-VSL GLDPMKRTCFIQSQIPELAELDMYYMNLVSL 35 9 26%
7235 ALN-26-AGI ALNNTLQDGLVRFERMRGKDVLWVPGADHAGI 33 12 36%
7236 LLL-28-NVL LLLAGGGGIELALLLLAKIALLEGEKLFVVGNVL 40 4 10%
7237 LLE-27-VID LLEKLCFLVELAGWVGIGEVIQAYQKRAPLVID 36 7 19%
7238 LVA-24-FGL LVAFLFIDLVIFIIGVEVAFALVLLSLFGL 43 4 9%
7239 LVE-29-LVA LVEEAQSAAAIAERFIDRFARGLTPAVDLVAALVA 43 10 23%
7240 DAL-25-EAI DALHREGVNARLMSAIPLKGAADDMSFAEAI 42 10 24%
7241 GSL-27-ELL GSLAAGALTTTYTASQGLLLMIPNMYKIAGELL 42 12 29%
7242 LVI-25-IVG LVIVGDALTTIADTPELRTAGGGGIADSIVG 35 10 29%
7243 LGT-29-ELA LGTDGFGRSDSRENLRHHFEVDARYVVVAALGELA 38 11 29%
7245 IAL-26-LLT IALVNAVHLLEADEQTNIAESTLGAAIAILLT 53 12 23%
7246 AIA-24-ALK AIAKLMKSFGNFEKAVTPVLDNYFHEEALK 49 9 18%
7247 LAK-28-LAS LAKEKEGVATGAYAINPVGGPEYPIWIADYVLAS 45 10 22%
7248 VAL-24-VFL VALAEAMEPEFKTYQQQVAKNAKALVAVFL 37 7 19%
7249 LDL-28-IAV LDLVDAKILATEESALFITHDLAVALAMGDGIAV 35 10 29%
7250 LEA-28-RIL LEAQLSARLTSHLLRPMAATEAGLSFSQLAERIL 41 9 22%
7252 EIA-26-DIV EIAHEHGIPLIVDNTFATPYLQRPLELGADIV 29 12 41%
7253 AIV-25-SGI AIVTLLFGEIIMLVLGLWTPVTFGLAGGSGI 36 12 33%
7254 AIG-29-GFL AIGAFPFARGWDLEGLGDPDPLPPGTLYARAGGFL 34 16 47%
7255 VLD-24-LDL VLDVELAAKGKDRLVALLAALLALAELLDL 40 5 13%
7256 ALT-24-IEA ALTSLLIAVEAALDFPDEEIDFLSDGKIEA 37 6 16%
7257 GIV-29-GIL GIVMAELLFALIAKVNRLEILNGLYLLDRLLAGIL 46 13 28%
7258 IGG-24-LDG IGGNGSGKSGLAMLLTGLYQPQSGEILLDG 30 6 20%
7259 GKL-25-LAI GKLDCEILALVKESEAFIEVPLFDEGMLLAI 34 7 21%
7260 ASG-27-SLV ASGATLALTSGTLQAEGLVELIDVKTVTLISLV 39 16 41%
7261 VVS-29-GGI VVSQRVPPGMTMMYHAQERIVNIPGSEITGQRGGI 30 14 47%
7262 FLA-29-GLA FLALEEIKGGKLRYGLIGGVLLLGSYLLLLLSGLA 54 20 37%
7263 GIE-25-SGG GIEEHNNYAVDFIEATRDIKRELPHALISGG 28 24 86%
7264 IPL-28-VLV IPLEGLAFIAGVDRILDMARTALNVVGNALAVLV 33 9 27%
7265 LLG-28-LDI LLGTPTRGRTLDNVLIIGAEDEDGIRLADGILDI 37 5 14%
7266 LGV-29-SGL LGVCDKIVPGLVIAALSFGHLPAAFLPSGPMASGL 47 10 21%
7267 GLG-28-DVL GLGKRLLHLPAFLSGGEMQRVALARAGVGRPDVL 42 9 21%
7268 VAL-24-VSL VALALKSLGMAVAFFWLVTAGAVFAFLVSL 55 8 15%
7269 LDL-25-DLL LDLTAKHLNNEIGDLLHTGGARATLTIADLL 42 5 12%
7270 GLV-25-VIV GLVPRVDISGDTVRYGRIINRGCHSIRRVIV 35 18 51%
7271 ELV-28-AIG ELVSTMRASFLVLGPLLARMGTAIVSLPGGCAIG 35 16 46%
7272 GSL-24-VLS GSLVEAEIAALVGVAALNSLLGLLEDIVLS 41 6 15%
7273 ELG-28-GVV ELGFEEVRTAALIAEALEAAGLEVARGVGKTGVV 35 11 31%
7274 ALT-25-EVL ALTRLEAGGDAGILPDTGRVCTGMAFGQEVL 39 15 38%
7275 FLL-28-VLT FLLGVLTTVLVSLWVVLGWMEDAQRLPLGKLVLT 33 6 18%
7276 GAI-26-ALV GAIVGAVSAFVLLGLTVGLKSLLALVIVLALV 52 5 10%
7277 TGL-28-LDI TGLHNRRVFDLLLELARLRALRDDVPLILAMLDI 27 9 33%
7278 VIV-26-LLF VIVALILVGVSGAKSVLVGGLIFAIAILALLF 29 8 28%
7279 SAI-24-LGF SAIQDEVILVAADLTPSETAALNLAKVLGF 28 7 25%
7280 GGS-27-VVS GGSSVADAEGIKRVAERIVEAVKQGNQLVVVVS 30 14 47%
7281 LDV-24-LSA LDVMDPDLDGFAVCKEERDALDHPAALLSA 36 4 11%
7282 LNA-26-AIE LNATILGQAIAFDLFVWFCMKYNWPPLMAAIE 27 11 41%
7283 ALL-27-AEI ALLAAAAAAADGLPLIGWVANRINPGLALYAEI 52 9 17%
7284 AGL-27-VVI AGLAGLLLAARLASALAQAGIGLELLVIAAVVI 43 14 33%
7285 LAE-25-LEV LAEALNEKPGETVGYRVRAQVCVGERTRLEV 40 7 18%
7286 AAI-27-ILL AAITGIILKAKIPTHVEIEAKPYLEDRDSVILL 50 11 22%
7287 VIG-25-VLL VIGAATLSLHLALHDRHTAVQFGDGAGGVLL 47 16 34%
7289 DAL-27-GGG DALNKIGKKTVIALREPSLGPVMGIKGGAAGGG 46 18 39%
7290 IEL-24-SAL IELLSEAGNDFSEAAILDGDLTPVFFGSAL 36 10 28%
7291 GDL-26-GSG GDLKAAIERDFGSVDAFKAEFEKAAASRFGSG 32 14 44%
7292 VLL-24-AKL VLLLALPDAGTVVLLLVTLLAMLFLALAKL 45 8 18%
7293 IAL-25-VLV IALGLGALGAAGIGLAAGALAGIALSTPVLV 54 6 11%
7294 ALE-29-LGT ALESEALAALFDDGRLFKVLELLLEVAEGLAALGT 34 10 29%
7295 LLT-24-GIE LLTEEIGDLVQLVGDDLFVTNPALLAEGIE 32 6 19%
7296 LGA-26-DLV LGAMQVSQAGDLANWMIPGKMVKGMGGAMDLV 45 20 44%
7297 VGL-26-ALE VGLGAEHAARFPHEFSGGQRQRIAIARALALE 43 11 26%
7298 DAL-29-IGA DALLPTMGGQTALNCALALAEHGVLEKYGVELIGA 41 25 61%
7299 GIL-27-VVL GILGKKVGMTQIFTENGELIPVTVIEATPNVVL 47 21 45%
7300 ALT-25-GDL ALTTSRADIISGSGGELASLSAAGFLRLGDL 36 4 11%
7301 PLL-25-NLL PLLSELQVLAAVAVLGVATAERGTAIRENLL 37 6 16%
7302 AKL-27-LGI AKLLEQQRGTIIENFNMFSGGALSRASIFALGI 35 8 23%
7303 TGL-26-ILG TGLLGVLAVLCSWLEIEKYGGFFHLNLMWILG 38 10 26%
7304 TGL-26-VAI TGLLAFIAAWNEFLFALTFAGGGAEITLPVAI 35 7 20%
7305 SGV-29-LLG SGVMIGAPLIAALAANSTIAMLAFVANGGIFLLLG 46 6 13%
7306 IGS-25-GIG IGSNQGLETKAMLEIIIEQATVPVVVDAGIG 34 20 59%
7307 LVF-29-VLT LVFGGCGSAVAAAAFLELGIGFAGVALAFGLTVLT 31 8 26%
7308 ALI-26-LVV ALILTPALVLAAQKVENIKGYSVKLLIRVLVV 50 6 12%
7309 LSG-29-AIS LSGGQPQLLQILRALIGNASLLVLDEATSALDAIS 40 7 18%
7310 ILA-25-AFL ILAAIGIRMGLDLPMPGALAAGTVLLSGAFL 43 12 28%
7311 ILL-28-LTI ILLLDEATSALDPQTTLSILQLLAEINRELGLTI 39 17 44%
7312 LAS-29-SGI LASLLAQISARASTVKQVWNDAVGELDALIESSGI 36 6 17%
7313 LDL-28-LIA LDLFGRLQSLLEASLVILLADRPDAARTRAHLIA 42 4 10%
7314 GVL-26-AIG GVLVCLDQWLPEAAALDALAGAEVLGLATAIG 43 7 16%
7315 GVL-25-DLV GVLDQTRRHSFISTLLGIKHLVVAVNKMDLV 37 15 41%
7316 LVS-25-GVL LVSEFLLDIQLLAENAPRRNRAISGLSLGVL 40 8 20%
7318 LIE-25-NAL LIEDNLKQVHPLFQTVFKTFLKDKEKIVNAL 33 13 39%
7319 SGL-24-ALN SGLDLLELAEANPSLADSYGGGELILLALN 36 6 17%
7320 LTG-28-VLL LTGLEVDKAELEYGGLGERVSQAEAILLDPDVLL 55 8 15%
7321 VLD-26-ALI VLDAVSRELKAYTALALLAANGATTAGTQALI 36 4 11%
7322 DLA-28-LLD DLAERLELDLSGGQRQEVAIALALAQEPDVLLLD 48 9 19%
7323 LVD-26-LVI LVDACYSPVERIAYNVEAARVEQRTDLDKLVI 31 15 48%
7324 AIS-28-GIE AISLLRNNREVILSAGTGNPFFTTDSAACLRGIE 27 8 30%
7325 LGF-26-FLL LGFLTDLDPDNALQKLADVLEGHYISEKRFLL 37 17 46%
7326 VSV-24-LAI VSVLSSSLLAWLSFTFAIGGILVLVDALAI 39 5 13%
7327 LDG-28-IGL LDGLEVAHEARKTSPAPLIMLQAKDSEFDKVIGL 31 7 23%
7328 VGK-25-IEL VGKLKEKYLKDGIAEYQKRLSRFCKFEIIEL 29 10 34%
7329 LLS-24-VLD LLSGGEQALTAIALLFAALLGNPAPICVLD 47 12 26%
7330 GLL-28-ELG GLLAPVERLVDGTRIYAAGDGTRLVQIRLARELG 46 11 24%
7331 AIA-26-DLV AIAEKRASWRGATENGFKVGTYEELIPGADLV 42 10 24%
7332 LAK-24-DLL LAKNAALEAIAFAMARLIARLAAGGAADLL 41 8 20%
7333 VAL-26-VLF VALAKPTELEVLQWYFQRYVKSAPTAGEVVLF 39 9 23%
7334 LVA-25-LEA LVALNALSTARLALVGGDVVLAAAVLAALEA 56 7 13%
7336 VSL-28-LTL VSLELQKILAKKGMLGKTLVGLSEIVEAGNQLTL 42 6 14%
7337 GAL-28-IVV GALYITFICLIPEFMSDAAKVPFYFGGTSLLIVV 41 13 32%
7338 SVL-25-ALG SVLGAVAGGLIGAPAAGGRGELVAIVAAALG 49 6 12%
7339 GGG-25-ILA GGGLIGDEAAGDAATLGRGVTLIAALASILA 48 12 25%
7340 GIA-26-AIL GIALDATEAVAERVAAGLDLLQAFLPDKEAIL 44 6 14%
7341 GIL-28-VLS GILDPEDARDAVRFGADGIVVSNHGGRQLDGVLS 41 14 34%
7342 LPL-29-VLS LPLLDAGLAFALIVGLLRCPPSFLLGLDHAVFVLS 48 7 15%
7343 LLP-25-VIG LLPEVWPGLVLGLRRCAIDLAGVIAEGGVIG 36 11 31%
7344 PLL-26-ELG PLLTKILDANDWLSVQVHPDDAYGLEHEGELG 37 15 41%
7345 FLL-27-LSA FLLWGSHAQKKGALIDGQRHHVLKAPHPSPLSA 44 20 45%
7346 VSG-25-GGG VSGGGRKPWRQKGTGRARQGSIRSPQWRGGG 48 22 46%
7347 ILV-24-TLG ILVFVGLRAELRGAAGQVIILAGVVIGTLG 39 12 31%
7348 GVV-26-GEI GVVSVSEIYEYYKEHGYETLVMGASFRNGGEI 31 9 29%
7349 LAT-26-DIV LATQTLKQGKAKTMKIEVEGKLPPGITAKDIV 29 23 79%
7350 DIL-28-GVS DILIDGGNTFYKDTIRRNKELAESGINFIGTGVS 29 21 72%
7351 GIT-29-KLA GITTYSPLRHWNAGPGKKVGVVGLGGLGHMGIKLA 30 18 60%
7352 YLL-24-LAI YLLAPLAIGLEVLASLLALAGALLGIKLAI 35 3 9%
7353 NLA-25-VLG NLAGLLRSLGEYEEALRLQGDVLALRERVLG 35 12 34%
7354 LTG-27-LDV LTGSAAAKSTRGEVLAVGNGRILENGTVKPLDV 32 17 53%
7355 VIV-27-AIS VIVNESGASVYSASELARKEFPDLTVEIRGAIS 30 12 40%
7356 IAD-25-GIS IADEALASLDMSMRSQLINLMLELQEKQGIS 28 8 29%
7357 ALI-29-LLK ALIRKGGELGGGLAELLAVIILNEIALLKRIELLK 46 5 11%
7358 LTG-25-ALE LTGFALDPAARQLALGVTMPLAPSLFVPALE 45 9 20%
7359 ELG-25-EAL ELGEHLILVVGEAPGGGEATGLILADAVEAL 53 13 25%
7360 ADL-27-VDL ADLSAIEVSGDSLAAAALVAANVAEAGLDGVDL 37 6 16%
7361 GIS-29-ALA GISEATAIGVAVQFGFPEFAQGILALIAVALVALA 51 7 14%
7362 LSL-25-DLA LSLAGNGSLLATHLDRAALLGEAGHLIVDLA 45 6 13%
7363 ALI-26-GKL ALIPDLTLLHFRNTTEAGIGLGSRDVNLHGKL 40 12 30%
7364 TLL-26-DLA TLLGVILGSVHVAGLLQALASRLGIVGGVDLA 43 17 40%
7365 ALS-24-DLV ALSGAGVLVIATANAAALWRLVAAGEGDLV 39 6 15%
7366 ALG-24-YGL ALGHPLGGSGARLFLTLVVTLGRSGARYGL 52 13 25%
7367 LVG-26-AIL LVGGALADIIPVSLIGIVFDALAGDDLAAAIL 56 2 4%
7368 SVL-28-VVI SVLLVVDAFDGPMPQTRFVTKKAFAYGLKPIVVI 32 19 59%
7369 LSV-28-ASG LSVFGALGSGALGLLVAALQDKAGITVAGVIASG 37 5 14%
7370 LIV-25-LGA LIVGGIGVALAALVALPERTIVIGILKALGA 47 11 23%
7372 AIS-29-IGA AISLLVVFLCLAALYESWSIPFSVMLVVPLGVIGA 33 15 45%
7373 VIV-29-DLA VIVQFGGQTPLKLALALEAAGVPILGTSPDSIDLA 30 16 53%
7374 VVI-26-KLA VVIEMNPRVSRSSALASKATGFPIAKAAAKLA 33 15 45%
7375 VDL-26-GID VDLHAITVPLDPETLRRRTLDIAALYLACGID 27 11 41%
7376 SAI-29-LLL SAIGIAGMDRLLGVNVIADSGRAVEAAGDVDTLLL 48 17 35%
7377 GID-27-GLD GIDLDIPAGDFVALLGPSGCGKSTLLGLAAGLD 32 16 50%
7378 LAL-24-AEI LALANSAGGALQLLDGPFDLKFRGRGEAEI 48 10 21%
7379 LTL-27-VVS LTLVLVATAQLRLDTPLEIKIRIVVFVAASVVS 37 14 38%
7380 LAE-25-VGL LAEYARKGPLAEDIRFFIDILLSLPSIVVGL 45 15 33%
7381 VLE-29-PLL VLEDPYILIDDKKISNIKDFLPVLEQVASSGKPLL 36 15 42%
7382 VGL-26-VSL VGLDPLGSAAFIQSQIPELGELSLLLMNLVSL 41 8 20%
7383 GIL-24-ALV GILISPLPGALAAKPGSATRPFLGVQPALV 48 10 21%
7384 AIG-24-VLV AIGQRIGAGPVRVIHDISEMDRVQPGDVLV 48 20 42%
7385 LVI-29-VIA LVITGTGRLDNQLIIGKFPLGVALCAARLLLGVIA 40 13 33%
7386 VLD-24-VLS VLDLALPDKNGYEVLRELRQFGESPPLVLS 34 11 32%
7387 LLF-25-AGL LLFLTLPTGGQGGSFLAAAGLFLALLLLAGL 51 6 12%
7388 PLL-28-DLA PLLMEFAALHPEVLGDKDLGDRLVDLVLEGFDLA 42 9 21%
7389 IDL-29-ALL IDLSVGSVLALLEAALAALVPEAVPALSSAIEALL 44 4 9%
7390 SAI-27-IDL SAIELAVGFASGLKLLLTSGTLQANMTVESIDL 28 11 39%
7391 SGV-25-GLG SGVGKGGLLFALLGLGSEIGTNTVALASGLG 41 6 15%
7392 IVS-24-LVA IVSNPPYIDEQDPHLSQGDVRFEPLSALVA 33 12 36%
7393 GIE-25-FLL GIENYSRHFDGRAPGEPPACLLDYFPEDFLL 27 15 56%
7394 LLI-28-LAT LLILEPEGLGALKAVLNKIVQGAANLFFGSALAT 47 8 17%
7395 VLG-28-LSV VLGLLVTPLDDLPIAAPALGLAAITIFYARPLSV 44 9 20%
7396 LVE-29-ITL LVELRQLGKESIAVYYQPGSAYLILARRALLSITL 37 19 51%
7397 LVV-25-VLI LVVLDLGAPDEDGLLSLARILQKAGLLPVLI 41 6 15%
7398 SVL-28-ALN SVLINGESGTGKELVAHALHRHSPRAKAPFIALN 31 15 48%
7399 GIG-25-ELA GIGAAVARLLAAAGAIVVIVARDAERLAELA 43 10 23%
7400 GAG-27-SLG GAGVGLVFSLIPLPLQRLGISVELLLALATSLG 47 12 26%
7401 ELV-25-VLA ELVKEEAGLDAGVIALVALAQIKVIIAAVLA 46 7 15%
7402 IGG-27-GSG IGGDGGAGGGAGAIFGGGSGGNIGLAAGPGGSG 36 8 22%
7403 ILV-27-ALT ILVANPVGFRAFELSLMGIRVDADALKFQLALT 37 8 22%
7404 VAI-29-LLG VAIGLGILALVIFRGVGATSLSIPLLAGPLTLLLG 49 6 12%
7405 VSV-24-SLV VSVGVMYMIKLAHMVDDKLHARSTGPYSLV 29 10 34%
7406 GDL-24-VLV GDLLVFNNTRVIPARLFGRKASGGKIEVLV 34 16 47%
7407 TIA-24-LVG TIAWEPADRDFIGREALEVLREAGALKLVG 34 7 21%
7408 LGY-26-LGV LGYLLAGIAIGPWGLGLISDVDAILHFAELGV 35 18 51%
7409 GLL-26-EVL GLLEIDGTELSADIAKAFNLAANRRALVSEVL 46 12 26%
7410 LVL-27-IVA LVLMILQAIVMDGKLAELGILAGVRWGALAIVA 47 8 17%
7411 LVL-25-GKL LVLAADHVIADEEAFRDAVRAAMPYAEAGKL 37 15 41%
7413 AGL-26-IPL AGLGGTGKEIIIANRIAGAFFFLGELLIDIPL 39 6 15%
7414 ALV-26-IVG ALVMLSDILPTAYELGVLLGAVKLGGVVCIVG 45 7 16%
7415 LAE-29-KLA LAEMAISSAQRRLRAAKKVVRKKLTSGPALPGKLA 44 12 27%
7416 LGA-28-FLG LGAFLVAALAWLLLGNAQKLPFATLQWGILAFLG 41 8 20%
7417 VIA-29-SLV VIAGDGKTLRRSYDKLRRRRAIHVISAFSTMHSLV 37 8 22%
7418 AAI-26-ADL AAIAAQGGALLSGLLVRLHIGLADALALIADL 53 6 11%
7419 VLE-25-LLG VLEAAGYFLLAVWIAQIPLLANLGAGASLLG 48 4 8%
7420 DLA-26-DLA DLAQACRSRYPRGVNLLLWLICELAIIACDLA 47 16 34%
7421 VLT-28-LGA VLTHGFLVDGQGRKMSKSIGNTVSPQDVANKLGA 46 12 26%
7422 EGL-27-VLE EGLVHISQIAGKRVEKVTEYLQMGQEVLVKVLE 36 14 39%
7423 TLI-25-LGT TLIPRPDTECLVETALARLPLQPARILDLGT 30 15 50%
7424 FGL-29-GLI FGLMVLMAGHGLSAGSGLNLGLGAGGIALLINGLI 38 8 21%
7425 IGS-29-ILV IGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILV 28 17 61%
7426 VLF-25-VIL VLFMVPADEPLGKGDDMIIERLKAAKVPVIL 31 9 29%
7427 LVF-25-ILG LVFAVDSIPAIFAITQDPFIVYTSNIFAILG 31 8 26%
7428 NVL-24-GLG NVLGVVIVYATLLVPSAILFESFLSFLGLG 32 20 63%
7429 LLE-29-SLG LLESVGLDEPALEALVETAKFALDTLAQKVEASLG 45 6 13%
7430 LGV-25-ADL LGVVVLTLTEVNSADEAILQTILLEAVLADL 44 14 32%
7431 VLG-26-VGI VLGNITIGENARIGAGAVVLKDVPAGSTVVGI 42 19 45%
7432 VLS-28-SLA VLSALLLSIGVLDDSRILDAAALAIFASGLASLA 45 17 38%
7433 LAE-27-EGL LAEIVKPQRILPTTMEFVDIAGLVAGASKGEGL 49 20 41%
7434 LEL-25-LSL LELAESSKLFGQKEIFERLNLLVQEGEALSL 50 6 12%
7435 ELV-27-ILA ELVDQAVEQGLTEPDPRDDLSGLDVMRKLVILA 38 11 29%
7436 IVA-24-GSG IVAGRQAEQDSGLEIDEENAERIGAAIGSG 32 9 28%
7437 IVA-25-VVI IVAMTLEEAEAAVIDMLAGNAFGEAGSRVVI 32 13 41%
7438 PLL-28-SGI PLLDVAMELEGAALADEYFIEKKLYPNVDFYSGI 33 13 39%
7439 ADL-29-LLN ADLVILVLNASELLTMLDRILLEIGKDTKRICLLN 33 17 52%
7440 IDL-29-RIL IDLKSYQCETIFVDPPRAGLDPETEKLVQAYPRIL 28 14 50%
7441 TGL-26-GSL TGLAWTEVGGDLLTIETACVPGKGKLTYTGSL 35 16 46%
7442 GVS-29-LIV GVSSLIGQGFETLVLAGFQATLALFELAHEFKLIV 31 10 32%
7443 VSV-28-ADL VSVSQVELDSHIQFYDGIRTSDIHETIIKAAADL 32 12 38%
7444 VIE-25-IVA VIEHNLDVIKTADHIIDLGPEGGDGGGIIVA 42 20 48%
7445 LDI-25-IAA LDIRRIGAVKEGDNVVGSETRVKVVKNKIAA 32 10 31%
7446 GIE-24-ISG GIEEHNNYAVDFIEACEDIKRELPHALISG 26 12 46%
7447 LIA-26-GEL LIAEAYSLLKELLGLSNEELAQTFTEWNNGEL 38 20 53%
7448 GLG-27-ALE GLGAPYWDADARGAIFGLTRGTGRAHIARAALE 49 21 43%
7449 AAI-26-EVL AAIARALAMSPKVMLFDEPTSALDPELVGEVL 40 14 35%
7450 VGL-28-LTL VGLGIILIVLLGNLLDPSLRGLVMGALFGRALTL 43 6 14%
7451 GIA-28-LVL GIACAAGIWVILAVNDLGGLWVSGLTTIGAVLVL 51 6 12%
7452 LPL-27-LGT LPLRGKILNVEKARLDKMLSNEEVGTLITALGT 36 24 67%
7453 SLV-29-GGG SLVNGGKAGAVITKGARPTVRSSVLDAIDIGHGGG 37 8 22%
7454 AIG-24-LGT AIGLVDGFGRKATLTLGFLVMGAGMSVLGT 34 6 18%
7455 LVI-26-LAT LVIGGGNEFRGAALEAAGMDRVTGDAMGILAT 41 10 24%
7456 IVG-24-LGG IVGAGLGFLWFNTYPAQVFMGDVGSLALGG 40 15 38%
7457 LLF-26-VLA LLFLALELLGLIAVVGLVLASLASQRARVVLA 51 4 8%
7458 ATL-29-LGI ATLAATSFALAIKGAINLALAEGELITRLLLALGI 46 6 13%
7459 GGS-28-ASL GGSGKTTTAAHLAQYLALAGGRVLAGDLDPQASL 38 10 26%
7460 GFL-25-VAL GFLIDWVIPKIPLHSDHALAYLFSPTDAVAL 39 8 21%
7461 SVV-24-NLA SVVVCPSGALKDASVFLLAAALQRAIVNLA 26 4 15%
7462 IAL-27-NVL IALLVLGISPNIGDLLSIIGAYGELRKLMPNVL 33 16 48%
7463 LVV-24-LEV LVVAAEGGLTKSGLPIRILTLDKRVDELEV 33 4 12%
7464 LID-26-SLG LIDELERRGVHVLVAEIEALNAAAIALLLSLG 40 13 33%
7465 EAI-26-AFL EAISNPITFAAEAVALNAVLALELLGHRLAFL 36 8 22%
7466 ILD-26-IAV ILDTPLAKVGGKGLFVKELEVALLANRADIAV 26 11 42%
7467 ITL-25-LVS ITLNRGAPDVFEQFNAAVQKLEEIQECHLVS 35 13 37%
7468 ITL-24-LLP ITLTFESGTDADIAQVQVQNKLQLATPLLP 35 14 40%
7470 TLG-24-GEI TLGLVGESGCGKSTLGRLIIGLEDPTSGEI 30 17 57%
7471 DAI-24-GLG DAITLLTQGGRLLCKFRLSGALTNNQFGLG 32 8 25%
7472 LLE-24-GDL LLEITRKGLGMTVICDEEAILDGIFTDGDL 41 14 34%
7473 ALE-25-LIA ALEAVGAAEAVGDELALARAAISKLIEGLIA 45 4 9%
7474 LGV-28-TIA LGVPKEQLIPVGAMLLAAALLEQIEDGQNTLTIA 35 13 37%
7475 VLV-28-YGL VLVLLVLVALALLAAAGFLPVVGTLDLVGANYGL 35 10 29%
7476 LVS-29-IGA LVSSANIACGFHAGDANTVHAYVSQADKNGLVIGA 37 18 49%
7477 LVS-27-AIG LVSSLRASFGFIGPLLAALGVAAVQATIGAAIG 43 13 30%
7478 IAG-29-VAL IAGERRLRALASLGLAASDAIIADVVDEETAVVAL 50 11 22%
7479 DAL-24-IVG DALERASKDGSTAGMTISELLRALLNAIVG 35 13 37%
7480 EIA-29-LLL EIAKIFRAGCIIRAQFLQKITLAYAENAQLANLLL 45 15 33%
7481 LLP-26-IAG LLPKLFAAILPGTALPTAPTWLGGGSSALIAG 41 8 20%
7482 GVI-29-VVL GVIIAIVFVGSALDIAGAGPQMLLAIAFPLALVVL 43 13 30%
7483 VLT-29-IPL VLTGATVGFALFYEVGFVLMLPLVFTEAAPAAIPL 29 7 24%
7484 LGS-26-LVG LGSAWAYYELGWGGWWFLDPVENASFMGWLVG 44 10 23%
7485 ISG-27-GSL ISGLRVALHSALGLLLGLGGVFGISSALGGGSL 33 4 12%
7486 IVS-29-ALN IVSVSDGIIRIHGLADVMQGEMISLPGNRYAIALN 28 14 50%
7487 VSV-28-IDL VSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDL 32 14 44%
7488 FLG-28-SLG FLGDWSPESAGDYASGTNHVLPTYGYTATCSSLG 34 14 41%
7489 SLL-27-IGS SLLAGLGSYLLTHTFAGFLLLPIVLGGALGIGS 38 3 8%
7490 ILA-27-IAG ILAKGGSEGLLKTLISAVFPGAQGGGLMFVIAG 43 7 16%
7491 LVG-25-VVL LVGASLGMALGLLLLLAALPALLGAAKGVVL 58 1 2%
7492 GVL-24-SLV GVLGAVLAAIIIAIALSAAALAAPLVRSLV 40 4 10%
7493 LVE-26-LAS LVENALAKLNAPLAIILDLGTGTGAIALALAS 43 11 26%
7494 LLR-25-LDV LLRRVRDFAEVRGVGEIQFGWADGALNLLDV 36 20 56%
7495 DLI-24-AGI DLILIGLIGMIDPLREEAAALIAVAKEAGI 30 6 20%
7496 TLI-25-SLG TLILIAFFAVYRLLFAYELQLALLFLGASLG 33 6 18%
7497 VEL-29-LVA VELAEKYGELTVVINVIESHHGDTEATSIIARLVA 39 11 28%
7498 VVI-27-EAL VVIDESVIQGEADIAGGALLANPAHLIGIEEAL 37 6 16%
7499 GGS-29-LGV GGSIGIGFAIPALLAKEVGDDLDEAGEVEAGWLGV 38 11 29%
7500 ITA-27-AFL ITAGMAIYDTMQFIKPDVSTICMGQAASMGAFL 27 14 52%
7501 VFL-27-LAT VFLALAALYESWSIPFSVMLVVPLGVIGALLAT 28 15 54%
7502 LLK-28-GVG LLKARIEDCRLRGGDPFDEVQLPDAVITLKQGVG 32 12 38%
7503 GLI-26-ELG GLISDPDLNGSLRVNHGLELARKLLLQVNELG 35 10 29%
7504 LIE-24-GIA LIEPGPIRTAAIDNVIQTQADKGSLNPGIA 37 7 19%
7505 LIV-24-LDA LIVQAVTPITQANGVQVIFASLTGDILLDA 34 9 26%
7506 VDL-27-AIL VDLKALLAGDLLAVATEDAISIACGVWGVEAIL 33 10 30%
7507 LDV-26-SVL LDVLIPGGAGAIALGIAYESLLLIPLAIVSVL 30 4 13%
7508 ALA-29-YLL ALAADAPKAGLQLIGAELGVLLALAAGDLTLAYLL 46 3 7%
7509 VLA-29-AIT VLAGAGGGKTRVIAEKILHLIVGGAGLAHSIAAIT 39 9 23%
7510 AAL-24-EIV AALRAEPESSEAQGFGFRCGFLGLLHMEIV 42 9 21%
7511 ALK-26-GLA ALKNIIAVGAGALHGLGYGDNAKAALITRGLA 44 21 48%
7512 VIA-29-LLK VIAIALACDPDILIADEPTAALDVTIQAQILELLK 39 15 38%
7513 RLL-28-LVE RLLLEAGAAVTVALLAEILQFTAAFPEGRDTLVE 48 6 13%
7514 IVL-26-VLA IVLAQALLVRLSYAAGLARVIFGLLILAAVLA 49 4 8%
7515 GAL-25-IGG GALTAVFSLREAFDKSVHFGFSRIAGNSIGG 52 8 15%
7516 GSG-24-LAS GSGILALAAAGLGALAAIGGALDPQALLAS 42 7 17%
7517 GSL-24-ALI GSLSAALAAAKLLNYAEGKALLIIDLHALI 45 2 4%
7519 PLL-26-GSG PLLLQDLALLEKLAAFVREVIPERRAHAKGSG 39 11 28%
7521 GAI-28-ILD GAIIAGAPLRRSAALGYFGLRIGIAFQIEDDILD 26 11 42%
7522 NLA-25-LLE NLAAQSFVGVSFDQPETTADITGLGSLNLLE 36 13 36%
7523 LLL-28-SAI LLLDLAFSGLPLALEALDPISPQYLGDLISWSAI 51 9 18%
7524 LAL-26-RIL LALFGAGLFAALSLLSEAGGEATAVTNILRIL 49 4 8%
7526 LLE-24-KLA LLEVNLGATAIGLGANTPQEAAPLLVLKLA 46 7 15%
7527 LLI-27-NLL LLISYPTALFLTRLKHKQLWLMLIILPTWINLL 39 11 28%
7528 ALS-25-GIA ALSMIVEAEKRGEIKPGDLLIEATSGNTGIA 45 11 24%
7529 ILA-29-LLN ILAESLGMFVYFYDIEAKVELGNAAAVAHLSDLLN 39 7 18%
7530 DLL-27-VIV DLLRRLQLEHGLGLLFIVHDEGVVAELADAVIV 31 11 35%
7531 ELA-24-VLG ELALRRVELKLARLAAHGVELLDPMAGVLG 48 6 13%
7532 LLK-27-ALI LLKQVGLIDARCRLAKVLSGGMKQRLEIARALI 42 14 33%
7533 VLV-24-AGI VLVRYRFPGLRIVDALVDLPFALPTAVAGI 46 17 37%
7534 GLV-28-IGG GLVSANFATLVAYGKITDTVWHATLPVLAVAIGG 43 17 40%
7535 AGI-26-LLP AGIIAGGFAIGFGLKIFGFLKRETVYTILLLP 43 8 19%
7536 AGI-24-VLN AGIDPTYPGYVFIVNEAIGLITPPFGGVLN 30 8 27%
7537 AIV-26-GSL AIVEGLAGRIVDGDVAEGLKAKTLGSLDTGSL 34 7 21%
7538 VIL-28-GEL VILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGEL 33 21 64%
7539 LLN-29-VIG LLNSCSDEEEATEKSFVDLNDKSRLKEPGSVTVIG 32 13 41%
7540 ILV-27-LIE ILVQGPNGFGRLPLGEIEAGEEALIALYRELIE 33 6 18%
7541 GAI-25-GAL GAIAAGVIGALVGGTGLAGTDRVLGAAGGAL 51 8 16%
7542 GVG-28-ALT GVGGGGGNAGNGMIGAGLIGVEFLVANTDAQALT 45 9 20%
7543 GEI-27-EIV GEINQLEGLNGAGISEFDNRLAGELMIPRGEIV 27 10 37%
7544 SGI-27-GAL SGIAHIIAAFNATLVVNTDEVGPVIAISSAGAL 37 10 27%
7545 SGV-28-GAL SGVAVLNALGMIAFIAGLRNAGFSPTLAPLEGAL 42 15 36%
7546 LTL-27-GVI LTLNGIIATLAGGTVALSLMAIAGARAGGLGVI 38 5 13%
7547 EVL-29-IAG EVLKGIDLEVVKGEFVSFVGPSGCGKSTLLRIIAG 36 19 53%
7548 VVL-24-VSV VVLTVLHAGAKFDGSLYKVSGGLHGVGVSV 36 6 17%
7549 VGL-26-IAA VGLIGERGTEFADFLANILGKEGRARPVAIAA 51 17 33%
7550 SGL-26-LLE SGLGIRLVEFLSIALAPFGALGRNEAMNELLE 45 11 24%
7551 EAI-29-GAG EAIEEAARIRLRPILMTTAAGILGVLPLVLAAGAG 39 15 38%
7552 ILV-26-NLL ILVAENSGIIGVADLKGLKLAFQAGSSIHNLL 30 8 27%
7553 GVI-26-VDL GVIPQYASHTLVQGIQRGLSLGNEEMNEFVDL 28 7 25%
7554 GVS-27-RLI GVSFEVERGETLGLVGESGSGKSTTGRLILRLI 29 16 55%
7555 ITL-27-ILG ITLPLAKPIIIYKALIAFILLWIDLGFLSVILG 35 13 37%
7557 GEI-29-GIS GEINSKALDPAPAINRVMQHERREAPAVDETDGIS 34 15 44%
7558 GSI-24-ILG GSIPVFVPGFGAALKLGLAGGPLIMALILG 31 7 23%
7559 VLF-29-ALV VLFIPPLLFADGSATPTLEFLLHGREIALLALALV 41 7 17%
7560 LAK-24-LLE LAKLFAKPANLLILDEPTNDLDVETLELLE 50 13 26%
7561 VVL-27-VIG VVLPHGVLFRGAAEVVIRLRAVGEALVLQAVIG 47 12 26%
7562 LVS-28-LLT LVSLLKGAAVNDRGPALRIGGALAERELGASLLT 42 3 7%
7563 VIL-27-VEL VILHADQSLEVIDDGRGMPVDIHPEEGVPGVEL 29 14 48%
7564 VLD-25-NVL VLDGGEGSNRLEGGAGNDVLKVSYWSADNVL 27 22 81%
7565 FLL-24-LDG FLLIDYKGGGMANLFKLLVHLLGTITNLDG 27 8 30%
7566 IEA-29-GIA IEAQASAGEGLQAGQQLSELGGEGLLAEALVAGIA 33 6 18%
7567 GKL-25-GAL GKLPIDLSQLKVDLMSFSAHKIYGPKGIGAL 35 15 43%
7568 ILD-24-GAL ILDRFPAMDGDASSFAADFRFIVSAIVGAL 30 12 40%
7569 IGV-27-LSA IGVMYLGKLVELGTSDELYRNPIHPYTKSLLSA 37 14 38%
7570 VIV-26-VIG VIVDLAAQNGGNCEYTVAGLVLTTENGVKVIG 34 10 29%
7571 GLD-27-LDA GLDYPTVGPEHAYGAPYGRLEYVLITDGEALDA 39 13 33%
7572 VDL-25-LLI VDLPTALLLSVVAALCACGASGVAGGSLLLI 31 12 39%
7573 VSV-29-VLT VSVTERTREIGLLKALGATRLKILTQFLIESVVLT 33 10 30%
7574 LDI-25-ELL LDIDEDFATVLVEEGFSTLEELAYVPMKELL 39 10 26%
7575 LLE-25-GSL LLEKESAPAVVQTGFNSGVAHALEMYEPGSL 41 8 20%
7576 ALS-25-ITA ALSSMANIAGYRAVVEAAHEFGRFFTGQITA 38 17 45%
7577 AGL-28-LNA AGLKAVPAIIKVLTDEEAMELALIENLQREDLNA 40 12 30%
7578 SLG-25-ELI SLGRTASFLDIYIERDFKAGVLTEQQAQELI 32 8 25%
7579 LTG-28-SGL LTGLASHIGMADLDAQEYTGARNARFSIFEGSGL 40 8 20%
7580 LID-25-GID LIDQLAKQNFGYPRHAKRDIDIAEHLVAGID 29 14 48%
7581 ELI-27-ITL ELIFGLIAGLLAWWSAWNINVAKAIKHALIITL 36 13 36%
7582 GVV-26-VIL GVVLSIIPWNFPALLALLKLAPALAAGNPVIL 33 12 36%
7583 GKL-27-AKL GKLSNAWFCGLPGNPVSATLTFYQLVQPLLAKL 30 10 33%
7584 GEI-29-TGL GEISGVVGTFRDITKQKANEGGLDYLALDDTLTGL 31 11 35%
7585 ITA-25-PLL ITALFIPTGWLPNETLAKLVGPMITYLLPLL 32 16 50%
7586 GSI-24-ALG GSIMKLGAIASAVEISTISTGSLSLDLALG 39 11 28%
7587 SLL-27-RIL SLLSIVQMPAGVPVATVAIGGAKNAALLALRIL 42 13 31%
7588 DLL-27-VLF DLLLLDEPTNHLDIGTIAWLTNYLKNPKKTVLF 29 16 55%
7589 LGA-29-AIV LGAGAAMLLVGFSGLLATLLALVLAIGLVVDDAIV 51 8 16%
7590 LVA-29-GSL LVAAVVDLSTVAVSRMLAAVLGAKVITLGLGFGSL 48 6 13%
7591 ILG-26-IEL ILGFDLLSEVYREARDSWKLDLALNGQYQIEL 30 13 43%
7592 LVV-24-IVG LVVLVDGAGAAASEILAGAIAGYGRALIVG 39 6 15%
7593 ELI-25-LVL ELIVDYGVKFLIRVGTAGGIGFAVHVRELVL 37 10 27%
7594 DLA-27-GGS DLAGLPGKLADCQEADPALSELYLVEGDSAGGS 33 10 30%
7596 GVI-29-LLR GVIEGLSLTIKPGEKVGLVGRSGAGKSTLVNLLLR 37 12 32%
7597 IEA-27-VVI IEAALADIIADLDAVRTEARQGSLLREGMKVVI 31 8 26%
7598 DLI-28-SLG DLIRPSVTAMRVIASVNAKFARGLKLPPHLRSLG 30 7 23%
7599 GVG-26-LAT GVGWSTLVSAELIAALRALLFMLISAGIFLAT 39 7 18%
7600 LFG-26-AIG LFGIVQGGEYEDLREESAKGLVELDFDGYAIG 36 25 69%
7601 EVI-26-LSG EVIEGLKVKLAGILLLGLLDAGDEDHRIVLSG 33 4 12%
7602 DAI-25-IAA DAIARRLDGYGAENARLIACRKPLTAEDIAA 39 7 18%
7603 LSL-24-AIG LSLLGVAIVMKASGFTLNLMTLGALVIAIG 47 19 40%
7604 LGI-29-KLA LGIKAFATLSTGEKIDGPDYSKLDKKIRRKQRKLA 38 12 32%
7605 ILL-27-FLG ILLSGAILTGGLSGIDGITVVALILLLLAGFLG 40 12 30%
7606 SAL-27-IGA SALGAGNDSAMAVPWPVSIALADIVDVALLIGA 45 11 24%
7607 LVA-27-GEL LVAALSSLALAGEILIGALLEAGLGALIGTGEL 45 9 20%
7608 LVA-26-GGI LVADFGGLPRARKYGRAAEVGRPFATVDTGGI 48 22 46%
7609 EVL-25-LGI EVLDASFSFDGVIGAFALTYRIFLMAGGLGI 42 8 19%
7610 EVL-27-GLV EVLKLAENQVEGAAERGLLHVLGSTADPVEGLV 39 5 13%
7611 AGI-27-IAT AGIKHNVLNAKFHANEAAIVAQAGYPGAVTIAT 35 15 43%
7612 LIV-24-IVA LIVAAFIGVAPQLIEAIGHGKASGAGSIVA 35 10 29%
7613 GIV-27-LLI GIVLAILSDTAGSVSGMAGAMLLVVPLPAGLLI 39 6 15%
7614 ATL-26-VLS ATLTARLIDRPIRPMFAEGFRNEVQVINTVLS 41 14 34%
7615 LGS-25-ALV LGSARFPEFRDGNIRAAAIENLKKRGIDALV 50 13 26%
7616 VGI-28-VLL VGIKDTQKTTCTGVEMFRKLLDEGRAGENVGVLL 42 17 40%
7617 VFL-27-AIL VFLVIYLFIQNIRATLIPTIAVPFVLLGIFAIL 36 9 25%
7618 EIL-25-LLP EILQDDSKCELIVVIDNHMTSSAKYADILLP 34 12 35%
7619 AIG-29-LEL AIGPAGLGGISDVDEILHFEELGVVFLMFAIGLEL 33 9 27%
7620 PLL-24-VIV PLLIGYTGGKLVGGERGGVVGAITTMGVIV 34 19 56%
7621 DIL-26-LLP DILHSRVARSNVVLLKAAGAEVTLVAPATLLP 31 9 29%
7622 LEV-24-AIL LEVLAANGVDVIVQENNGFTPTPAVSHAIL 31 14 45%
7623 SGV-25-ILV SGVVVLGAGAGKLIVGLASLAAAQADGLILV 35 6 17%
7624 IPL-24-SLV IPLLDVLGLLGKLFQLFLVDLTGALLLSLV 29 3 10%
7625 LLS-26-LFG LLSVVAAVSACGASGVAGGSLLLIPLACSLFG 46 16 35%
7626 LVL-25-DVL LVLVDSLNDVLALLESLTLVDVDALSDVDVL 43 18 42%
7627 LGI-26-LVD LGIEGVSGAGKTSLSAPLAGFDLPGLGEVLVD 35 6 17%
7628 GLS-25-ISA GLSQEVKEQVKITLDFRLGFIDFARVAFISA 36 7 19%
7629 LAI-26-IVL LAIILLSLGMELILLALTTALLGAISLLGIVL 46 4 9%
7630 GLI-25-IAL GLIFVGYGILIDYPAALQSMLLILYLLLIAL 49 12 24%
7631 ASL-27-LDL ASLALNIPVIFVSGGPMEAGKTKLSTFIIALDL 43 8 19%
7632 GLV-28-IVL GLVAGLLFGAALLVLAALAFHLIAILFLVLGIVL 48 7 15%
7633 ILG-27-AIG ILGGVITVVGTAPLSSMALTALLGLTGVPMAIG 42 14 33%
7634 GGG-24-GVI GGGGKAGAVPNYVIRFLNDKHNRANIRGVI 39 12 31%
7635 DAL-28-VGK DALLDYGRPAGIGLAVLVDRGHRELPIRADYVGK 35 13 37%
7636 EIA-24-ALG EIALEDHLGTACDPIAGLVSVGCAVRKALG 40 5 13%
7637 TLA-29-VVL TLANVLRSTGARVSTLRYTLAALLLDALARALVVL 48 7 15%
7638 IVG-26-EGL IVGPANIPFARYSVSKQLLDRVIRVYGEKEGL 30 7 23%
7639 ASG-29-VLT ASGGFADLAALAALAIIVAPAVRGRIPPVVDRVLT 35 11 31%
7640 TGL-25-TLL TGLPLRILSPLVALLLGMDVSGWGIMALTLL 38 13 34%
7641 SIA-28-DLL SIATASLLGALLEKLEAIAAAGFDGVELFENDLL 33 6 18%
7642 LFG-25-GGI LFGSTIDGLKGAAGGALAAIGGTLVIAAGGI 36 5 14%
7643 LAL-28-YLL LALVFLGYNAPGPLTFNTEELLNLPTSLGVEYLL 50 6 12%
7644 VLA-27-LGF VLAKKAGALATLIKDRNPEYVADYLAFAMELGF 46 9 20%
7645 LDL-27-ASG LDLKFHDIPNTVAKAVAAAADLGVWMVNVHASG 37 19 51%
7646 LVG-24-YLL LVGLLIAGPLALAPPAVAGALSIKELEYLL 34 4 12%
7647 VVL-27-GIE VVLPDAELKIFGVASVEERAERRYKENQIKGIE 33 11 33%
7648 GLV-27-LSV GLVLISELVFEVVKDPSVVLLEGGKVMVKVLSV 40 13 33%
7649 GVL-24-GGI GVLLAYMFFGRGSAKQSAGGAAIIHFLGGI 37 13 35%
7650 GVL-28-SGI GVLGAKQYLLRLFIILRGFVLDFSREAGGGISGI 34 10 29%
7651 ILG-25-YLL ILGLTFIGLRASSIHGAALLSGMAQSVGYLL 30 6 20%
7652 EIA-24-VFL EIARALVAGGFGGDVLGPIALLGGLGRVFL 24 4 17%
7653 GSG-25-AIA GSGVPAYAPLLMLLIAIASFLDFSRLKLAIA 47 6 13%
7654 EAI-24-LVL EAIAAAILLRFRPIGMTLLAALLGALPLVL 39 8 21%
7655 DLI-24-LEA DLIVRGAGLAGAGIAADAAGRGLLLLELEA 37 6 16%
7656 DLV-27-IVG DLVVGSVIAIAISPQQALISALLSHVIKADIVG 30 6 20%
7657 LDA-25-DVL LDAGLGAVATALGALSGTAAVSDLKDAFDVL 47 7 15%
7658 GVS-28-FLA GVSDPEQKRKIIGNEFIYVFDDEASKLKGVDFLA 31 14 45%
7659 SGI-29-FGL SGIGFGATVKAKSDKASEGELLIQGEPEDLIKFGL 29 8 28%
7660 GGS-25-PLL GGSFVAETVFSIPGLGGTEFSAGAKSDTPLL 34 20 59%
7661 LDV-26-VLA LDVLAALCLGPGLADAAAVALLSIGGVLTVLA 40 2 5%
7662 IEA-28-GVG IEALTEAIKLARAGLGHEHKPVGSFLFAGPTGVG 32 13 41%
7663 GVV-27-VVI GVVVAETVEQAVEAAQEMLLDNKFGDAGARVVI 32 12 38%
7664 LDI-24-DLA LDILQRLIDAALVRDTADTAALAVVAQDLA 30 3 10%
7665 LAL-26-LVF LALLIASLGVLLHASNKLIILALLAALLFLVF 49 7 14%
7666 SLL-25-NLA SLLHGLGFSNEQAERPVSDFSGGWRMLLNLA 36 7 19%
7667 LSL-24-KLA LSLNANIEAARAGEAGEGFAVVALEVRKLA 46 12 26%
7668 LLK-29-VIG LLKTAAYGLLRFSLPLFPAASAEFAPIAMWGGVIG 36 7 19%
7669 GVL-25-IGS GVLALILISCYVAAINAAAKWYVASGGVIGS 33 6 18%
7670 ILG-26-GIL ILGALALGRLRFKGRKTINASFYIVYMFAGIL 41 6 15%
7671 GIA-29-LLN GIAYQSASKGVPVEMKDIADKSLDLGMTEAAKLLN 34 10 29%
7672 AIG-28-IAT AIGLDPGSDDLSQLRYGKICILADADSDGLHIAT 37 16 43%
7673 LVI-25-VLI LVIACPYALSASTPVLIAGGTGASAELGVLI 35 8 23%
7674 GVI-26-GLL GVIGARLFVGSSAAIAEAGPALLLVYLGAGLL 47 11 23%
7675 AIE-28-IAA AIEKGFRETFPDAQTAQVPVADGGEGTVAAMIAA 38 6 16%
7676 LDV-27-GVL LDVARTDADTFGREVGVLDAQKVLDLQDVFGVL 34 7 21%
7677 LVL-26-GGS LVLLTMAIGELVAAQGEAMARNLRAQAAYGGS 37 7 19%
7678 LAS-27-LLD LASPAGLDLESLQYVLYDLDFKLNADGEKRLLD 52 9 17%
7679 ALK-28-LLP ALKTLADNEGYETFVIPDDVGGRFSVLTAVGLLP 37 17 46%
7680 LGA-29-DIL LGALAAGEKGRVTLPALDRYAEAIGLAFQVQDDIL 34 15 44%
7681 LDL-24-VLT LDLGLPDMDGLEVLEQLRAHGPELPVLVLT 35 15 43%
7682 LEA-29-LGY LEAAVEDLQGDVIGLPECKLLGPGFPREEIAKLGY 29 16 55%
7683 VSL-26-AIG VSLLVGGIGILNIMLVSVLERTKEIGILRAIG 37 10 27%
7684 LIV-24-SVV LIVLGTSSSESALPRMLDKMEKLGCRKSVV 30 17 57%
7685 LLR-29-LGG LLRRPPGREAYPGDVFYLHSRLLERAAKLSDDLGG 44 23 52%
7686 SLV-28-AIG SLVYVTPILGGRLADKVLGNRKAVMLGALLMAIG 36 8 22%
7687 IVG-29-ILL IVGLLDTLKTTCTGVEMLRKLLDEGLAGENAGILL 44 11 25%
7688 GEL-27-LTG GELAIHAGTVEKGYWNLPAETAGAFIPCFLLTG 39 12 31%
7689 GGI-25-GLA GGIAPGALAKVDLGLGAGMLFLLLILAAGLA 42 2 5%
7690 IDL-28-LSA IDLGEYQFGFHDDVEPDLSTGKGLSEAVVRELSA 34 7 21%
7691 ILD-26-LAI ILDSIVVAPHLQGARFIDVGTGPGLPGLPLAI 31 8 26%
7692 DIL-29-VGK DILIPPDAIMGAREGAEVVVELTQRPTRGTKAVGK 26 7 27%
7693 IVV-29-IAT IVVVENVERRIELGESPLEAAKKGTGEVTFAVIAT 27 15 56%
7694 IAD-27-ALE IADIGTGLRAYECPLIFTNYIKKGENAGYAALE 36 6 17%
7695 VSV-29-RLL VSVQARLLDLLRGLVAELELAVVIVTHDLAVARLL 38 13 34%
7696 LDI-25-VAL LDIALGAGGYPKGRIIEIYGPESSGKTTVAL 30 15 50%
7697 FGL-25-DIV FGLGSSAAVAHDAGNKFFRFNVPVPYSEDIV 25 9 36%
7698 LDG-26-GLV LDGEEVVLRSPADALANGAPVIVEDRKGEGLV 37 6 16%
7699 AIT-28-LLK AITGHRQRRQKARPTSALDDIPGIGPKRRKALLK 31 15 48%
7700 VFL-28-LVS VFLPLLLMGGSVGRLFREFALTLSVALLISLLVS 30 14 47%
7701 LIA-28-GSL LIAALGRLGVQTASVIAVLGAAGLAVGLALQGSL 42 11 26%
7702 LTL-29-IGG LTLGQEISGPAIMLEPSEAVIAESLSALRELAIGG 37 10 27%
7703 LAS-26-LFG LASISWLVTLTQPLFSVRILEFSARDLIGLFG 38 10 26%
7704 GLS-28-VIA GLSGMERVVRERMSIQDTGSLTPQAGINIRPVIA 48 9 19%
7705 VLS-25-EAL VLSLADDIAHFIKPQFNPPFVVGAKSLGEAL 47 8 17%
7706 VLS-24-LPL VLSLVGAFGAALLALLLSGYELIAILILPL 43 11 26%
7707 LAA-26-IGS LAAAIFGFAGAIGELDVSEAMGLGQFGAVIGS 47 4 9%
7708 EVL-25-IDL EVLDTGGDISVPVGKETLGRVFNVLGDRIDL 33 7 21%
7709 VLE-27-NAL VLEDAMDDTVNDTRLLDRSKAPWLKNEAELNAL 30 5 17%
7710 IAG-28-AGI IAGQGAIGLEIGEALLDVDNVIVPSGGGGLAAGI 52 10 19%
7711 LSV-28-GVL LSVPLGALAVMLDLLVIKGDVAGLRFPGTGLGVL 45 12 27%
7712 GIL-26-FGL GILIGILPVLVMKVLGGLGFLATIFSSADFGL 34 4 12%
7713 DLI-29-ASG DLIVKKGLANLDFADLLTVIENKGSAAGAGGGASG 30 7 23%
7714 IGV-29-LAK IGVTFGLILPAAFDLTLLDFEDLEDGVIRIRQLAK 34 7 21%
7715 EIV-25-ALK EIVGNLAKRMVKLATAPIEVHLTLDRREALK 33 9 27%
7716 LDG-24-LGV LDGTKEFIKRNGEFTVNIALIEEGLAVLGV 39 12 31%
7717 TIA-26-ATL TIAMGSSDGLGRGLDVLDLGHHIEVPVGKATL 36 13 36%
7718 AIA-28-IGG AIAGAILASRLGAASPSAGAFAELGVIAACVIGG 50 13 26%
7719 LGV-25-SAI LGVVAELIAFALSLKLFRVASAYAGLLDSAI 37 4 11%
7720 LTL-24-KLA LTLLALLFMIAFAIGISGSGDILFRSVKLA 37 11 30%
7721 LDL-24-LGA LDLVVAGTSLAVLMVESEAKLLSEDAMLGA 48 19 40%
7722 AGI-27-SAL AGIGDALGLALLGLVLAAARAAAGLDGLGGSAL 45 2 4%
7723 EIA-28-LVG EIAQEAEMDYETVLNNLDKAAQAKLIEVVKKLVG 36 13 36%
7724 TLA-24-GEL TLAIVGESGCGKSTLARLLTMIEEPTSGEL 42 21 50%
7725 GSG-28-ILV GSGPIVIGQAAEFDYAGTQACLALKEEGYEVILV 29 20 69%
7726 AIG-27-FLL AIGNTLRAEIGEAAVGAAEAVFYENGGTIEFLL 40 9 23%
7727 LVI-27-VLE LVIAVADIPVALAGVDGGTATEIGDGAGAVVLE 32 8 25%
7728 NLL-29-ALN NLLGYRHYADDVVAAFVFLSAENGIDIPRIFDALN 29 11 38%
7729 ATL-26-VAI ATLFNIPITLDGELNAEGILATILNGAQIVAI 37 9 24%
7730 GVV-24-ASG GVVTEVCVAFPALSAIEEGFEVFVVTDASG 41 13 32%
7731 AIS-26-GIL AISRATLRNIKLNLLGAFIYNSIGILVAAGIL 33 8 24%
7732 ITL-29-EGL ITLAEAGKVRDWSYLAAKKPETIRAATLKPEREGL 28 14 50%
7733 VVI-25-GID VVITGDGATRPAGNDVKVTWPSAKKGVGGID 27 8 30%
7734 AEI-26-NVL AEITEKLRARGINVRFGIHPVAGRLPGHMNVL 28 12 43%
7735 SAI-26-LLF SAIILKASVSGIMTAALLAIALILGETAPLLF 37 6 16%
7736 IVS-28-GSG IVSLGADGAFAKHKDTFYKVDIPKIKVVNPVGSG 27 16 59%
7737 VIE-28-LVE VIESAASKTGKAHVIKSHHNVGGLPEEMKMGLVE 35 24 69%
7738 LDG-27-LSA LDGDAVEASGKFLKDSTLDNRDLTGVALGTLSA 41 7 17%
7739 AIT-28-LLR AITQPGVLKIKKGLIILLADILGLMLSIVTVLLR 29 6 21%
7740 SLL-29-LDG SLLDYNDFVGRIGIGRVFRGTVKVGDQVTLSKLDG 41 12 29%
7741 LSL-28-IDL LSLQIILPALVLTRLAGIGASGRTEDLAKLLIDL 36 10 28%
7742 VLL-24-GEL VLLARAVPIEQLAEFNRFLEVAYLLLVGEL 45 10 22%
7743 VLL-27-ISA VLLDLFKPEGYGFLLLQLERGQSQGGTIKLISA 41 5 12%
7744 LVL-27-AFL LVLILLTGSPLGILLTRASEGLLVFYFLGIAFL 47 11 23%
7745 LIA-27-ELL LIAVPVSFGIALFLTEVAPGWLKRPLGTAIELL 55 15 27%
7746 ILL-26-VGL ILLAALLFMLAFIGITLAAIILHPGQALLVGL 47 6 13%
7748 LGV-27-AFL LGVAIEFAGIVALVLTAALALAAVIACGAVAFL 37 10 27%
7749 AAI-29-AIE AAIKDELKDRLHLNAYGLSGGQQQRPCIIACLAIE 38 8 21%
7750 VSL-26-LLT VSLAVLATIIALIGLGLLALLRADGAAGLLLT 41 4 10%
7751 IAG-27-LVI IAGMLLSADETDTPLIQNLANLSKLLTGAILVI 36 7 19%
7752 GIL-28-LVG GILLQVVPDYEHLKDAYELLWEMPGNDGYLQLVG 43 14 33%
7753 IAS-26-ALT IASGAFQVAKPSDLIPELQGRLPIRVELQALT 36 17 47%
7754 DLA-27-AIV DLAELVLRAPGLSVAEGAPGLIAGLWEVAGAIV 33 8 24%
7755 IDL-29-TGL IDLPAADPERVKEEIEEVIGIDASDAVAISAKTGL 29 17 59%
7757 LTI-27-ALT LTIETACVSGKGKLTYTGSLGEVMQESIQAALT 36 12 33%
7758 AIL-28-GSI AILMSLGLALSLIVMSKAASSSSVSLEQYLFGSI 31 12 39%
7759 LGV-27-VLF LGVNLRQTSGPVIEKAGDLAALLTNLEPGDVLF 38 21 55%
7760 SAL-25-GIA SALIKSQIENTSPNFDVTEVGTVTYIGDGIA 50 16 32%
7761 LGA-28-LLF LGAILLALIMIISGLWLLVLLLSILPIGGAFLLF 47 15 32%
7762 LGA-26-LNA LGAIILKSTLLAACSTNAGHDQAATDAGTLNA 36 7 19%
7763 GLI-25-ILL GLIAGHLGGIPFGSNGLSTIIASGLIGAILL 55 7 13%
7764 GLI-27-LVG GLIGGDLARIVAAASAAALLAGILAIGLGDLVG 45 2 4%
7765 GGG-24-LVD GGGSSYTPELIEGFIKRYDELPVRELWLVD 39 21 54%
7767 SGL-27-IVA SGLNHYPLGKVLYAKLFAADEIILALIAAAIVA 37 2 5%
7768 EIL-25-GSI EILGTLGLSGKGKSDLRRILLGLHIADSGSI 27 17 63%
7769 IEA-24-IVV IEARLDKGKGPVATLLVQQGTLNVGDPIVV 31 21 68%
7770 GAI-24-LSV GAILAAAILFSAVLLAGLTGGGKTEEYLSV 33 7 21%
7771 DLI-29-VVI DLIEDVLRRPMRESYESENDEGFKTLCPALRAVVI 26 7 27%
7772 GVS-26-GAL GVSLLLAVALLLRGVLLLGLVASLLGAGLGAL 43 5 12%
7773 VIV-26-GIV VIVTTPQDIALLDARKGLAMFEKVGVPVLGIV 38 14 37%
7774 ISA-29-AGL ISASLGGTEPALYEHNLAYIMPILNGMIGSGFAGL 44 18 41%
7775 TLG-27-AIG TLGQEFSGYVRQLGVGAELIWLSLAHLVELAIG 37 21 57%
7776 VDL-24-DAI VDLNTIPTAAIERIEVLRDGASAQYGSDAI 30 17 57%
7777 GGS-29-ATL GGSRFSVSGPTAAFVVILYLISQQFGLAGLLVATL 34 10 29%
7778 SGV-25-GVG SGVELILTKLHAGGKFSNKNYQFSGGLHGVG 34 15 44%
7779 EIV-26-GLG EIVKPQRILPTTMEFVDIAGLVKGASKGEGLG 32 14 44%
7780 VIE-29-GLG VIEQGEVAPLGADMQDAGHRDAVCAAIAWLLQGLG 35 11 31%
7781 LGT-24-VIL LGTIGMGFAWRGALQILGGIHWLGDLSVIL 33 6 18%
7782 SVV-27-ISG SVVDEAAGAIHLQLADSPKFGNVVINNGGKISG 28 12 43%
7783 LGY-28-VLL LGYREIKQTMQLSRLTLRSKKPELVEQELWGVLL 34 20 59%
7784 LLS-29-ASG LLSLGGKLLAAIQIILLPVMGAGSLLLLLGVGASG 47 6 13%
7785 SLA-24-LFG SLAIGGDGMAVSLLAANSPIAIYFAAFLFG 42 8 19%
7786 LVE-29-LLI LVEFLNGCICCTLRDDLLAEVARLAAEGRLDYLLI 35 9 26%
7787 LVE-26-DLA LVEKGAELGALTEAVAMAVDHPVGKFDLLDLA 42 8 19%
7788 GIG-27-GVI GIGGVLEPLQANPTIIEDNCFIGARSEIVEGVI 35 17 49%
7789 EGL-25-LAT EGLLSALDLLAARQGAKAGRLLAGAILGLAT 34 4 12%
7790 GFL-27-GVL GFLGAGVIMREGLNVRGLNTAATLWCSAAIGVL 35 9 26%
7791 GLV-24-YGL GLVGERSGLYPQKQRWSDIERATFSFGYGL 30 8 27%
7792 VIA-28-LGY VIAGFPAAFISMFFTGSLLIEVMFSLNGLGLLGY 28 10 36%
7793 LIE-26-VGL LIETSEPLRGDIVVFKYPEDLKLDYIKRAVGL 37 7 19%
7794 GVI-26-EAI GVINFAYYLAKNGKRYSDGSANNLTHKTFEAI 31 15 48%
7795 GVV-24-LGT GVVGFKTHAKMLLILRREGGKLRRYLHLGT 32 8 25%
7796 GKL-24-GLS GKLIDITGISALLSGYVQQKASGAWFGGLS 33 9 27%
7797 IGS-28-VIL IGSGPIVIGQAAEFDYSGTQACLALKEEGYRVIL 31 23 74%
7798 LAK-26-DIV LAKRIIPCLDVIDGQVVKGVQFRNHEIIGDIV 34 14 41%
7799 GLS-29-GEI GLSVCVLAQVGLNIGCTFCASGLGKKARDLGAGEI 35 9 26%
7800 EVL-29-GGS EVLSADAFSRFEEEGIFNAETGRRFLDEILSRGGS 33 15 45%
7802 ISA-29-ISA ISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISA 29 17 59%
7803 IVS-24-VLV IVSGELGEDFTYYLATSEQTPSSVGLGVLV 32 11 34%
7804 LNA-28-IAL LNALLGAAARVGLLVTLDGAILAELAAVESAIAL 33 4 12%
7805 SLL-28-ELV SLLFKLDGSLIILPFVHLLAESMLKLSFPKAELV 38 8 21%
7806 ELL-24-IAL ELLSIGIQPDILICRSDRAVPANERAKIAL 47 15 32%
7807 LGI-25-GGS LGINVDSGTGKLLSVVALMCACGASGVAGGS 35 11 31%
7808 ALI-24-ELI ALINDPLILLLDEPTSGLDPESRRQVAELI 35 13 37%
7809 AGL-28-GID AGLSAEEREENQERFLREDVIIVVATIAFGMGID 43 24 56%
7810 IAA-29-GIV IAAMIGGSLITAGAGAGIGSFIAAFIFAGISFGIV 43 6 14%
7811 IAA-29-ITA IAASSALRSELLSRRTSAALLDGAATGGAAGLITA 37 9 24%
7812 LIE-26-LIE LIEKSFREVAKKMDFQILEFNGEEDHVHALIE 37 11 30%
7813 AAI-26-IEA AAIVPLTVGAAPFIARLVENALLEVDKGLIEA 39 21 54%
7814 GAG-27-SGV GAGGAAHLPGMIAAKTLAPVLGVPVQSAALSGV 43 14 33%
7815 EAI-29-ELA EAINHSKAATVPIIVAINKLDKPGANPERVIAELA 44 11 25%
7816 DLA-28-VLD DLADGHVVAMSKLARDVGLHIYNLGAGVGYSVLD 41 11 27%
7817 LDV-25-LVE LDVRVDEEGNKQVAVSGANELSGVSLEQLVE 37 6 16%
7818 LGL-26-DAI LGLAVSGGHDAALLAGDLTLFLLIGETAADAI 41 9 22%
7820 LLV-26-VLI LLVLLLPGALALSGLSGGLALVLIVAGAGVLI 48 3 6%
7821 LTL-25-VIV LTLNDIVGLEAGSQSFRIAKSILNKGVQVIV 37 15 41%
7822 SAL-29-FLA SALSIQDPRERPPDKQQASDLKHRRFADKESDFLA 36 10 28%
7823 LAI-26-LDL LAILREERVILCGAVLHCFTEDRETAGKLLDL 39 9 23%
7824 SLA-27-GVL SLAVDNIFVELMLFGYFSVPPALQQRVLILGVL 49 13 27%
7825 ASL-29-LGS ASLLSGRLDSAWARVSRPWTLAAWAFLTLGIVLGS 44 16 36%
7826 KLA-25-ELA KLAPALAALLLDVKKGSEAFALTALKLAELA 45 13 29%
7827 EIL-28-LLN EILKEDDGSSDVEAEILVKASQDAFSEIILILLN 35 5 14%
7828 AKL-27-NLA AKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLA 29 14 48%
7829 VSV-26-ELL VSVLEDIQNAIALLEAGAVGVSDLGGDAGELL 42 5 12%
7830 LDG-25-ITL LDGTSIYLTMAAVFIAQATNSDMDIVHQITL 27 11 41%
7831 GFL-26-IGL GFLAAGAIIIGAGLVKGLTTAAGAWVTAGIGL 35 7 20%
7832 ALL-29-NVL ALLVILAGTLAGALGELGQLQPHFLAATAVTRNVL 41 5 12%
7833 ALI-27-LEL ALILSPKVIIADEALAALDMAMRSQGINLPLEL 39 12 31%
7834 LLK-24-IPL LLKIAGILLIVVAIELEGLLQELSSFQIPL 32 2 6%
7835 IAA-27-GLI IAASANFPVILLSGAALRATTRGAVIGGQIGLI 47 11 23%
7836 LVE-26-VIL LVEDLVNRSIEPLKVALKDAGLSVSDIDDVIL 39 25 64%
7837 VIL-29-VIV VILMDEPTSALDPIATAKIEELIDELKKNFTIVIV 33 18 55%
7838 VLD-24-LVL VLDRLLPALSGLSVIEQLRLTGGRSPVLVL 46 4 9%
7839 IVG-28-LIV IVGLEALSRWFHKLDGLLTPSEFLLLAEEIGLIV 37 9 24%
7840 IGG-29-GLF IGGGGSLLALVILGEFSKLLGLDALGRLAFLAGLF 31 7 23%
7841 LVD-29-ILG LVDQPFLDKYCVGYDEKTLPADAPKNGHYKAYILG 31 13 42%
7842 VAI-27-VLS VAIARALAMNPDVMLFDEPTSALDPELVGEVLS 35 11 31%
7843 TLI-25-LAS TLIEEVQVLLLEADLVSILAKLDGLLAYLAS 39 6 15%
7844 VSG-27-GVV VSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVV 35 14 40%
7845 GGS-24-ILL GGSTITQQVALLFFLTGELSFKRKITEILL 29 10 34%
7846 LDG-24-LEV LDGKRGTAATILYDAFDLIKEATGNDALEV 29 14 48%
7847 LTI-28-AAL LTIATGFVVDDAIVVLENISRYIEAGEKPLAAAL 43 15 35%
7848 LVL-26-GSL LVLARLPDAPAGVKGISLFLVPKFLVNADGSL 50 12 24%
7849 LLD-25-LLF LLDLKAARLLPGAEVEKELDLILLDARDLLF 36 5 14%
7850 LGI-29-YGL LGISLSGTGKELEARPYAPGQHGPNQRKKLSEYGL 32 11 34%
7851 ASL-24-LLP ASLGYVHAMAHQLGGFYDLPHGLCNAILLP 49 14 29%
7852 ASL-25-LAT ASLAPLGWALGDLAVAVLLSGLDLERLTLAT 49 9 18%
7854 LLR-28-LGF LLRYWRADLAREALFWHVQLALSAFNAKDIGLGF 32 6 19%
7855 IGA-24-LAS IGAGLAAVVGLLKGRLADAVLKAAIQVLAS 46 2 4%
7856 EAI-27-LAI EAIARNLREMARLKVPVICTVIGEGGSGGALAI 35 26 74%
7857 GAI-26-GLG GAIPSALCAVLRLIPGLTAHAANGPALGLGLG 43 6 14%
7858 VLT-24-LPL VLTVTQMLRKHGVVGKFVEFYGDGLASLPL 39 15 38%
7859 LDA-29-LVV LDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVV 39 13 33%
7860 FLA-24-SLA FLALLEALPEVLILPAQAASLLAIGAKSLA 43 9 21%
7861 IVV-26-LAS IVVEAANGPTTVEATEILTTRGILLVPDVLAS 35 10 29%
7862 SGV-24-LLR SGVYVGSLEVMEGFTIERLRTLESRTGLLR 32 6 19%
7863 IAD-28-DAI IADGPATDRGELALGKNVLVAFMPWEGYNYEDAI 28 17 61%
7864 LNA-28-ALL LNALLALAIGQAERLLILKLAATAMRIDIVGALL 48 6 13%
7865 LGI-29-VGI LGILVKYLASDIGTLERVEIARLLRAGLLTVLVGI 40 7 18%
7866 ILL-29-GIA ILLRPAEYDVIATLNLNGDYISDALAAQVGGIGIA 45 15 33%
7867 LAK-28-VLD LAKTLLYAINGGVDEKLKIQVGPKTAPITDEVLD 35 15 43%
7868 EVL-24-EVI EVLEGLEPVRRRPGMYTDTTRPNHLGQEVI 35 17 49%
7869 VVL-26-IAS VVLGCAFQSVAPLIIIGAIAGSIAMFGALIAS 36 9 25%
7870 LVS-24-ELG LVSFTGSTRMGRRVGPNAAKRFARIALELG 33 16 48%
7871 VSL-25-VID VSLGEIEGALAAGYNPQTHPDDIVFTADVID 27 6 22%
7872 IAG-28-ASL IAGGAVLAISLARDSSVEVIGDGVILAGGALASL 46 3 7%
7873 GAG-28-ILD GAGAMRMMFLIIQPGCLAPLIVQALLNPSSAILD 30 20 67%
7874 LVI-27-LTG LVIMDINLPGKNGLLLARELREQANVALMFLTG 34 13 38%
7875 ALT-24-LLK ALTAVSFLGAVGVVIAGYGENIAGESTLLK 38 7 18%
7876 VLT-28-VLE VLTSLNGIDEAARLADTIAAHMPLKLADKQSVLE 32 10 31%
7877 GVG-24-IAA GVGGDALDIAAGSLAGRLGLNFPAGPTIAA 46 6 13%
7878 GVG-29-GGS GVGGREIGYLAGMYKKLSNNFAGVFTGKGLSFGGS 38 26 68%
7879 LGS-29-LVA LGSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGLVA 44 24 55%
7880 ADL-29-VLN ADLDLAVLDAPFALRVYGLTAQLGEVGIAVLPVLN 28 6 21%
7881 ASG-24-SLA ASGGYTAALKEVNEILRDLSRPLLFSNSLA 47 8 17%
7882 VIE-25-IVG VIEVENLTKSFGDRVLIDDLSFSVPKGAIVG 30 21 70%
7883 GDL-25-VLN GDLLIHEGAACDAQKHAAKVFNADKTYFVLN 24 17 71%
7884 LIA-29-VVS LIAIGNGTASRETDKLAGELVKLLGALGLQKIVVS 41 9 22%
7885 SAL-27-IGG SALVGTTGLVISGVGIALHGELLLTGGSGVIGG 40 3 8%
7886 ALV-25-VIG ALVASLGFVPMALALGAGAEVQRPLATVVIG 50 10 20%
7887 IGL-29-AEI IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEI 31 11 35%
7888 ILG-24-VSV ILGLAALVRPFTVHSDVGRRELPLMLVVSV 31 6 19%
7889 GGG-26-SLG GGGLFETGAGGSAPKHVQQFVEENHLRWDSLG 43 20 47%
7891 LID-28-VLV LIDEALEGGPVDTVADDLRSELGLFIPGADRVLV 34 5 15%
7892 LID-27-ALT LIDGNVEDAIVAAGESAQGAFNIEIGGLIEALT 32 15 47%
7894 ELG-26-LLP ELGATLAPILWQSAQAGAFDAADAGGFLVLLP 37 7 19%
7895 IAS-24-GLI IASLVILVDQLLKAYAYELSKQLSVFVGLI 36 11 31%
7896 SGI-24-LVG SGIDLGAGAFLAIGLANLLVLPGEAVVLVG 35 4 11%
7897 LTI-29-LLF LTIPFLKVGGKLLAAKAEAAALEALEAKNALTLLF 31 6 19%
7898 SAL-24-GLI SALFLSSNIDFAYTSAIVLLAAKFIDRGLI 49 6 12%
7899 ALV-24-GAI ALVVSGAVAAALGVDFLQSPLVLGTLIGAI 48 6 13%
7900 AVL-25-FGL AVLADVNVVHGPLEVLLTITEEAGMLGAFGL 48 11 23%
7901 LAE-27-AGI LAESLGGVESLIIHAASMTHAAMAAEARAAAGI 51 12 24%
7902 IGL-25-ATL IGLSAKNALLIVEGAKDLMDKEGKGLVEATL 51 9 18%
7903 RLL-28-VID RLLGTLIHLRDLGNTVIVVEHDEDAIDAADHVID 33 14 42%
7904 LVV-29-ALT LVVDDDLLLLRGLGVALRGEGIRAVAAALGTAALT 43 5 12%
7905 LLN-25-LAI LLNEAFRTLKLLVASIGGLVLKFLGDALLAI 37 3 8%
7906 LLP-25-LAT LLPATTGIVAKLTFAPARALRLAGVAIALAT 45 10 22%
7907 PLL-26-GIL PLLAPMSEVAGRMAAQIGAQFLEKLNGGKGIL 36 14 39%
7909 GVG-25-VLT GVGMGMSLHAGVVNVADGGRGARLREGRVLT 33 20 61%
7910 TGL-27-ATL TGLGAPYWDPYARGAIFGLTRGTNANHIIRATL 43 25 58%
7911 DIL-24-TLL DILETDVEAKSRYILLPFIGVSGDDKSTLL 34 5 15%
7912 VDL-25-AGI VDLVIEEGVKVVTTGAGNPGKYMERLHEAGI 33 8 24%
7913 GAS-27-TLG GASQADAAVLVAAELGGVAEDTALTIFAALTLG 41 15 37%
7914 LGT-26-VLS LGTDDVGRDVLSRLMYGARVSLLVGCLVAVLS 39 15 38%
7915 FGL-28-LGI FGLAVTGALATELVKLNATAGAGCKLFLTKPLGI 41 10 24%
7916 GLS-28-YGL GLSLTGTGKELALRNLVPGQHGPNNRSKLSEYGL 28 8 29%
7917 GIL-26-ITA GILQELYAGGLIDLQAAIPVLLGDNIGTTITA 30 13 43%
7918 GSL-29-LDI GSLSGGEKQRVAIARALLTAPELLLLDEPLNSLDI 28 12 43%
7919 GIV-24-LNA GIVLHNGDIPEMRTGEGKTLTATMPVYLNA 28 17 61%
7920 FLL-28-ALE FLLMNTGEKAVKSKNGLLTTIACGLRGKVAYALE 33 15 45%
7921 AKL-28-DLV AKLAGAPFVKVEATKFTEVGYVGRDVESIVRDLV 29 15 52%
7922 GLD-29-ILG GLDNAMAGELLEFSNGVYGMAQNLEGNDVGIIILG 30 12 40%
7923 VVI-25-IAV VVIALLGVSELIERFRTLRAVALAGGLAIAV 31 5 16%
7924 SAI-27-LFG SAISTALTLAAGATIVGAAAILIEFLFIALLFG 28 6 21%
7925 IVV-26-FGL IVVVTIAFAFNGTLTALKGVKSAVVLILIFGL 28 4 14%
7926 RLI-28-LGI RLIAGAENMPIDILRVRDDDIPGLVMDGVVDLGI 33 10 30%
7927 LLG-24-ELV LLGRQVGVPYIIVFLNKCDMVDDEELLELV 56 20 36%
7928 LVL-29-IGV LVLLGLSGGAAMVAVALGVEAVEERAARIAVLIGV 41 9 22%
7929 ALI-29-GAI ALIGFAGPRVIEQTVREKLPEGFQRSEFLLEKGAI 43 21 49%
7930 VAL-24-IVV VALAIGSTLWWPNKAVKGELKSREGFLIVV 38 6 16%
7931 VVL-29-LVS VVLVGAGPGDAGLLTLKGLQQIQQADVVVYDGLVS 38 8 21%
7932 VLE-29-AGL VLENIDLSKALGEFVCLLGPSGCGKSTLLRAIAGL 45 19 42%
7933 GIG-25-GAI GIGGPDTSIAVEELAQLGVRTFLRIGTTGAI 42 13 31%
7934 DAL-24-LLT DALIVKGLELLGGLAFELLVDLAQLLALLT 48 4 8%
7935 AIV-29-SLA AIVNIGSGFFAAGLLALPAYAASKAALGALIRSLA 38 7 18%
7936 GIV-24-VLV GIVGAGGSGKRTPRILDKALALPLSGRVLV 36 5 14%
7938 GLD-26-ALT GLDYHEFAAFTRHHDALAFLEAENPQRLFALT 36 10 28%
7939 GLD-28-NVL GLDIRILSPVEATKFSLERIRAGEDTISVTGNVL 26 15 58%
7940 IAD-27-AIL IADEPTTALDVTVQAEILELLKELQREMGTAIL 31 15 48%
7941 LGT-28-ALE LGTEGLVAVLFPLFPGVPIAPIDLETALREAALE 36 11 31%
7942 IGS-25-ALL IGSSVSGLAAFLFVVPLSFAIPAGIAVIALL 58 1 2%
7943 GSI-26-LVS GSIFDHTAGGLLLTAYSMPIFQWGMMLILLVS 34 7 21%
7944 DVI-27-VAL DVILIFKDAGEKVAAYLLRDFDESLGVNDRVAL 30 10 33%
7945 LVF-25-LTL LVFTAASAVVTAGFNGAAGGAFQLILDSLTL 35 6 17%
7946 LLG-26-DLI LLGPKFEIVLGALALASAYSLTGLVGGHPDLI 39 11 28%
7947 TLL-26-IEA TLLGALLDQAYKLNLNSTGFADEEAVEQHIEA 42 7 17%
7948 LAA-28-GIT LAATFSPALADLTAYVIDVALGALIPRLGGPGIT 50 9 18%
7949 ILG-29-LVV ILGGPAQAISGEEEARTIYAGVAHTTGGAGGRLVV 40 9 23%
7950 SVL-27-VGL SVLDNVAFGLDVAGAPRSERAQLALLLLAAVGL 42 8 19%
7951 EIA-28-SLV EIASASDEQSRGIDQVAQAVSEMDRVTQQNASLV 30 17 57%
7952 VIL-24-GID VILGTSATRDPRAVNEACKLFGGKLAVGID 28 6 21%
7953 GIS-27-ILA GISPAGGGKTLAAGFPSDLSLTRKKLPALLILA 35 12 34%
7954 VIV-25-VIL VIVLLINEIYSQLILLSELLGIESGLLLVIL 35 4 11%
7955 ISA-28-VVL ISAPLCFEIEQRLILALWIPVFHDDQEGTAIVVL 41 10 24%
7956 VGI-26-EVL VGIARALANNPEVLLFDEPTSALDPELVGEVL 32 19 59%
7957 LNA-24-VVL LNALNLDMLRELDAALDALAADDNVGAVVL 29 7 24%
7958 LDL-25-LVF LDLGARPLKTFFTVIVPLTKGGIIAGSMLVF 29 7 24%
7960 GLD-25-GSG GLDYLTLSRSAGTLSGGEAQRIRLASQIGSG 32 21 66%
7961 YLL-26-VIL YLLAGVLAGPFTPGFVADQKLAPELLELGVIL 35 10 29%
7962 LLE-29-VAL LLEALKPLGLGGVAALEVLLIKLNEYDKLVAAVAL 53 3 6%
7963 AIA-26-ILD AIARALALEPEVLLADEAVSALDVSVQAQILD 40 20 50%
7964 AAI-24-LVV AAIDGAGPIRRFFGIALPLIAPVSFFLLVV 47 11 23%
7965 IAG-28-SGG IAGTKKDAFRTFNATEDLGLRLQLIHRPAKLSGG 36 15 42%
7967 LSV-26-LSL LSVQANAVNWATVKFWQQMGLTRVILSRELSL 51 15 29%
7968 LPL-28-VAI LPLGTIDGEDARDFDDAVYCEKKRGGGWRLWVAI 43 12 28%
7969 VLD-28-IAL VLDLFYNTPARRKFLRTEKTEFNHIDEILRRIAL 35 9 26%
7970 IAS-27-LSA IASGVFGSILAFSGIVSLGVLLIGQNLLDALSA 43 6 14%
7971 LGF-27-AVL LGFLWFNTYPAQVFMGDVGSLALGGALGIIAVL 43 14 33%
7972 DAI-29-LGL DAIHYKIKEDGRYISKAVYTILALNVIGKKEILGL 38 13 34%
7973 VSV-28-IAA VSVVMKVVEKKGTKQVAEAYLKYLYSPEGQEIAA 36 8 22%
7974 LDI-24-GLL LDIPFGEIGGLLGPSGCGKTTLLKQIFGLL 41 17 41%
7975 LVF-26-LGA LVFAGLSAAVYRAARVLLVPDLLLLGAAGLGA 37 4 11%
7976 GVL-26-IGV GVLLASSEYRHALESDDEPFAGLLLGLFFIGV 36 7 19%
7977 ILG-29-GLD ILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLD 32 15 47%
7978 LVE-24-ASG LVEHKKDVIILLDSITRLARAYNTVVPASG 36 22 61%
7979 VLE-27-LSL VLEEELLKRFAAGEDPRYLTLRRLDFGGCRLSL 42 12 29%
7980 DVL-28-IVV DVLLLDEPTNGLDIQSISWLEDFLIDFENTVIVV 28 19 68%
7981 GSG-29-DIL GSGKEFMGPATMGTGVISGGPVRAVLELAGGTDIL 31 5 16%
7982 VLD-27-ILA VLDNVSFTAAMKDKVILVGKSEAAKTTLLKILA 36 10 28%
7983 VLT-29-IVA VLTCATKAGVCASCYGRSLAVGKAVDIGAFVGIVA 34 8 24%
7984 LGS-26-LLD LGSFVVWRRMAYFGDTLAHASLLGVALGLLLD 39 10 26%
7985 VSV-24-DLA VSVQAQILDLLRDLQRELGLAYVFVSHDLA 33 23 70%
7986 YLL-29-NLL YLLRDIPFGTDGFAWNEDDTEKENTDLANDFGNLL 28 19 68%
7987 SVV-26-LGA SVVLAALLATGIAVVKLNVNGGAIALGHPLGA 41 9 22%
7989 LLV-27-NLL LLVALEEGLDVAAFASLSPAIIVPDTLDPINLL 41 9 22%
7990 IAL-29-ISA IALSNIAQASAVFGIILISAKFNEREALVPAAISA 39 11 28%
7991 ALV-28-VSV ALVSGARTAFVGDTALLLVENGRPATLIPFVVSV 38 6 16%
7992 VLS-26-LIE VLSALILALLAKAPSGALDEIQLTDAIDKLIE 37 6 16%
7993 VLV-25-VIA VLVAARRARQMQVGGKDILVPEENAKVAVIA 48 9 19%
7994 LIV-25-VIE LIVCNGEIDRTQELDALILLKLDLGVEIVIE 26 7 27%
7995 LTG-26-LEA LTGKTVALAARELLAGLTPGGLSSFEAVALEA 47 6 13%
7996 LID-26-ALK LIDFVAAEADGSKADAGFAEDAVKIAATGALK 38 16 42%
7997 GSL-29-LVL GSLTLIATALGVTFSFMDEVIFEEFKLTGGMELVL 48 7 15%
7998 ALT-29-RLI ALTAASRAIKLRLPALGRDIADVAARLIGKLERLI 30 7 23%
7999 ELI-26-TLA ELIAINDAGLAPGGGSVGIGFAIPSNLLRTLA 36 6 17%
8000 LLF-29-EAI LLFGIPLLEALLITVLDVFLLLLLMKLGFRLIEAI 27 10 37%
8001 FLL-28-LVA FLLALLFLGSGIALFVLLAADALAPAVLLSVLVA 45 4 9%
8002 IAV-25-LLK IAVDTHIFRVCNRTGFAPGKNVEQVEEKLLK 34 16 47%
8003 GEL-26-GEI GELVFLIGANGAGKSTLAILLAGLYQPDSGEI 31 15 48%
8004 GVG-29-LDG GVGKILLTDEAIGVLPLELLEQRYILPDAVEILDG 34 6 18%
8005 AIS-27-GVL AISLTAGTARSLELGQHISDAAALLRHRPHGVL 35 15 43%
8006 VGI-26-ALI VGIAAAGGALKAYPHELIGGMRQRVTIAIALI 40 9 23%
8007 FGL-24-SLL FGLAFAQMFTPGVGKVILALAVMSCLGSLL 42 10 24%
8008 ITA-28-LLG ITAGGSTNDATPTLTGTALANSTTSIFDGTTLLG 40 14 35%
8009 LLS-29-GFL LLSQLLGGPVIVSVSTNYNTALEAQALKAVDVGFL 41 13 32%
8010 LIA-24-ASG LIALWAHKALDGKTRITAAGKFFIATQASG 45 7 16%
8011 IAL-29-LVV IALALILLLAGALAAGLGLSLTFLALSSAIIALVV 49 8 16%
8012 LAE-29-YLL LAEVGAMRTRRLAMRQSLVKVLKTEMDDRLFDYLL 36 6 17%
8013 ILG-29-VAI ILGGTYLPRKFKTTVVIPPQNDVDLHANDMNFVAI 38 11 29%
8014 LEA-27-LSG LEAKDGVLILGEVDTLASILLQNADELLAKLSG 44 8 18%
8015 VIG-27-ILG VIGLILLLVVLLLWGGIIGVIIHFLLLSGLILG 40 3 8%
8016 LSV-29-TLI LSVGGEYGTSATYMSEVALRGRRGFFSSFQYVTLI 34 20 59%
8017 LIV-28-SGV LIVIPNQNLLRIADDKTTFADAFAMADQVLLSGV 29 10 34%
8018 GIA-28-GGG GIAHTMEEALAVAAAVGFPCIIRPSFTMGGTGGG 42 14 33%
8019 GIL-25-VLI GILADDMGLGKTLQTIAFLTSNLSSDSLVLI 35 9 26%
8020 ILV-28-AAI ILVTLMTDPDWVPVMKRAAAIITDEGGRTSHAAI 40 15 38%
8021 DLV-24-GVV DLVELCLAAIAGKLDGKTSEWDERASLGVV 32 10 31%
8022 GGI-24-ALK GGIAAGFLAGYGAKLIITDIKLPQSMEALK 33 15 45%
8023 DIL-28-ALT DILVPNPVLEDAFELSSMGIRVDADTLKFQLALT 29 8 28%
8024 IGV-24-GLI IGVGGIAEGATLTALIALGATAVQLLSGLI 45 7 16%
8025 ITL-25-LLF ITLFYAAKGWDGAALSLTLFSIAFVGTRLLF 33 10 30%
8026 ISA-28-ALV ISATGRIGLNLTGRQNFIQTDAAINPGNSGGALV 39 18 46%
8027 TLG-25-SLA TLGNRQASEFLPARGVDEKELADAAQLASLA 39 14 36%
8028 GAS-25-SGL GASTLQGKKVVIVACGAQGLNLGLELRDSGL 36 6 17%
8029 GAS-26-IVG GASLLLFAGLGEAALLALLFAAAIGGFANIVG 35 3 9%
8030 ITA-26-GAI ITAGEAKDPQFTLRSAVGKVIWRILIFYVGAI 32 14 44%
8032 GLL-29-YGL GLLLAGHTDTVPFDDGRWTRDPFTLTEHDNKFYGL 39 12 31%
8033 TLL-26-GAI TLLFKDKFTKEEREAGLAAIVMGLSFITEGAI 47 19 40%
8034 ILL-27-IAV ILLGFGVGLHFSLKDLLLVKSIAIPGAIAVIAV 49 7 14%
8035 LLT-24-LLF LLTGSLWGKIAWGAGWEWDARLTAVLALLF 44 6 14%
8036 LAS-25-LIE LASRHAQIALRIDKLAQLWREAIGELLALIE 38 6 16%
8037 GLV-27-LDV GLVHVSELSRKHIDDPTDVLEVGQEVIVKVLDV 38 14 37%
8038 LVV-29-SGG LVVAADKGTATFSDIANGVAAEYGFWLGDAFASGG 44 20 45%
8039 DAL-29-GID DALVADFPGLTRDRKYGRAEIEGQAFIVIDTGGID 33 12 36%
8040 SGL-24-SGL SGLALLIDGGAHEQALDAAGALIAVLGSGL 38 8 21%
8041 LLR-26-GIG LLRPAEYDVIATLNLNGDYISDALAAQVGGIG 35 15 43%
8042 DVL-28-LVS DVLLVPALSKVLPMPQNEDTLLTRLIELSIELVS 36 12 33%
8043 ALT-26-LEL ALTPAWGLRQDAGRSDLMAVLSLQGRASLLEL 41 11 27%
8044 DLA-27-IAT DLAQLIFDLKQVNPKALISVKLVSEPGVGTIAT 31 12 39%
8045 ATL-29-IAS ATLIVYEIRQFIFNLLQLTVSAGVAPFAFLAIIAS 34 12 35%
8046 IAD-28-LVL IADEPTAALDVTIVAQIIELLLALQQKENMALVL 33 12 36%
8047 EIV-25-GIS EIVSEPDMRSPEEAYAYLTALKEIIQYIGIS 26 17 65%
8048 IAT-26-ELV IATRQSPLALWQAHYVKDALMASHPGLVVELV 32 11 34%
8049 TIA-24-VLV TIAITDVDNGDEPVFSNTTATGTYGELVLV 32 10 31%
8050 FLG-27-LLE FLGKQDFVSESLQLSDLFLLLSEKESFGLVLLE 35 7 20%
8051 LLS-29-IVA LLSQGDTTGITSLESAIGVSVLIILLPENFEAIVA 43 9 21%
8052 SLA-25-ILL SLATSIGRLANVFLEILGQAHRLLFSSPILL 49 9 18%
8053 LAE-27-ALK LAELTGLACVPAEDLIEATSDCGAYVMVHGALK 49 12 24%
8054 LDL-28-EIL LDLRLFLMSDAVTAGLKGFKIGEGKNILLMLEIL 36 7 19%
8055 VSL-25-ILA VSLDIAVNYCHDMKLFKMSRRNIGQAGKILA 42 12 29%
8056 ELI-24-DLI ELIAHGREVDEIRQTIGADGLIDQDLNDLI 31 11 35%
8057 ATL-29-LNA ATLAIALAALLIGALIDLGIGTERGAEEGAAALNA 33 5 15%
8058 TLI-28-IAA TLICNKTIIGFGSPNKATSHACHGAPLGAEEIAA 40 11 28%
8059 VVS-24-ALG VVSGGTDNHLFLLDLVDKGLTGKEADAALG 44 15 34%
8060 ISG-27-AAL ISGLGAAGAAAFMLLVQRVFNFFGTSGLGQAAL 52 8 15%
8061 LFG-25-ALG LFGWMSLAAIVRLAFLALRNFDYVLAAQALG 49 8 16%
8062 LDV-27-GIT LDVTDELEVAALVDEIAEEEGKVDILVNNAGIT 25 9 36%
8063 IAD-25-AIA IADMLTRIRNGAAANKAAVTMPSSKLKVAIA 37 17 46%
8064 LTI-27-SGL LTITKALLNVIADAKTKVYGDADPSLTYQVSGL 33 12 36%
8065 VGK-24-LGL VGKTVPPKRLILKLISLSFFPGAKDGDLGL 31 12 39%
8066 ELL-27-IVV ELLELDVAILVPAALEVQLTEENASEIHAGIVV 35 8 23%
8067 LVL-26-AIV LVLSDVGLGLFLSAAAMAALAEGLILGAVAIV 48 2 4%
8068 ASL-26-SAI ASLMALHDRDVYRTMACGIAGLSVAADSLSAI 37 11 30%
8069 LVS-29-VGL LVSYQTLWLKIHYPAEFMAAVMTADMDNTEKVVGL 40 12 30%
8070 RLL-24-AEI RLLDRTTRQVRLTEAGERLIRLVGPALAEI 37 9 24%
8072 EVI-28-LLE EVIVKELEEDKLRLVMVFADREFAVNEVIRYLLE 36 13 36%
8073 GFL-26-VLG GFLGPNGSGKTTTIRILTGLLLPSSGAVRVLG 39 17 44%
8074 AIG-29-IAS AIGLVGGIALLIALAVGLLEALAFGLAGLDVLIAS 34 2 6%
8075 IVG-24-EVL IVGMRLYGDAGVAIATGVLTFVVLVFAEVL 33 7 21%
8076 RIL-28-EAI RILQIPGLRLARPGEFSERAFLNDKLDLAQAEAI 29 12 41%
8077 RLI-26-GLV RLIQETGFDGRTQGILHALEGKLIGGEDEGLV 34 6 18%
8078 LLS-24-EVL LLSILLEICLGAKEAGGFARVFLSLLLEVL 43 6 14%
8079 ELL-24-TLG ELLGAAGELIKRGLGSAALALGRGAHATLG 41 5 12%
8080 LLE-26-VSL LLERNDVIVVASVSCIYGLGSPKEYADSVVSL 41 11 27%
8081 IAL-24-SLV IALAAGASDVIGREDIVDTRDEALAGCSLV 45 8 18%
8082 VIA-25-VSV VIAGFKAAVERAGAACKAAGAKRALPLPVSV 39 18 46%
8083 AAI-27-GIA AAIFAAQLYGIDLSIWQEIILVLTLMVTSKGIA 47 12 26%
8084 IAG-24-LPL IAGVILFILLKRLAVPSSLAWLLYIYLLPL 41 7 17%
8085 GIA-26-GDL GIAEDVKISELSEEQIDTLRDEVAKFVVEGDL 31 12 39%
8086 IVA-26-EVI IVAAIADKFVKIADRSKEVGVLGIFPLPVEVI 30 10 33%
8087 LAT-29-AIV LATLGVLITSGLTGMMAAWLFNLDLIEGLLIGAIV 35 15 43%
8088 DLI-26-LVI DLILLNGFKLEAIAKLVGFVDAAGVRFEALVI 29 4 14%
8089 DLV-25-GLI DLVLFVADSPGVAAQELGALRVAVAKELGLI 32 7 22%
8090 ASG-27-IVG ASGRAIASDCADGMTKLIFDKETHRVIGGAIVG 35 22 63%
8091 VSG-27-IVS VSGAAQHIYEPVIGGLTLVMAGPLAASGVIIVS 27 6 22%
8092 GLD-27-VVI GLDDAQIAEACEEAAEGQVVSPVNFNSPGQVVI 28 14 50%
8093 LTI-24-SLL LTITLKPLCEILVLRLEYIDALLINAGSLL 37 6 16%
8094 FLG-28-LVA FLGIVGAIALAGYDGALYSIGFLVAWLVALFLVA 40 11 28%
8095 GFL-28-AGI GFLYKKAGSREEPLLHGGGQEGLARATTENIAGI 33 8 24%
8096 NVL-26-EAL NVLLTGQIELNVLLIRPYLAAALSRKQALEAL 31 4 13%
8097 TLL-26-GIL TLLGLLSLLVAGALDALFGTIAGALLFDAGIL 43 3 7%
8098 ILA-28-ILV ILADVQGLGKTIEAGLILKEIAKIGLLKKVLILV 40 6 15%
8099 LIG-25-IVL LIGGIAGYVIEITGSLTLTEIVGRNPYVIVL 48 7 15%
8100 ALE-28-LIG ALELRDGDKSRYLGKGVLKAVAAVNRPIAQALIG 38 11 29%
8101 SAL-24-IAT SALLEAMEEGQVTIEGVTRKLPRPFFVIAT 36 26 72%
8102 GLS-29-LVV GLSALAARVAPIALLQLLLNLLIVGAIAALTTLVV 44 7 16%
8103 GLS-26-TGL GLSGGVDAGEWVALAGIAGGGKLTLVFVDTGL 39 20 51%
8104 VLV-28-VFL VLVPLVRIVNFMGIHDTLAAVILPLVGWPFGVFL 33 8 24%
8105 LGG-28-EVI LGGAISPLDGIGPDDLHIGELVERLSEGAIKEVI 30 9 30%
8106 IAA-24-EAI IAAAKSLSLGLLPAIIALMPALATAAIEAI 40 6 15%
8107 VIA-26-TLA VIANALYHRFPAVDEGDMSRMRATLVRGNTLA 43 13 30%
8108 AGI-26-GVG AGILAQIPDKFDRGEGALIGIALPAAGGGGVG 43 11 26%
8109 AGI-28-GFL AGIRVVPLPGACAAIAALSAAGLPSDRFCLEGFL 38 15 39%
8110 LIE-24-ALN LIEPGPKALAEPELYDVRANVMWAATLALN 29 12 41%
8111 VSL-25-GAL VSLSLAVALLLILSTVILLLISLAGLALGAL 47 5 11%
8112 LPL-28-ITL LPLVGALVILDRRLGEILTLLGAPPVALFPSITL 33 7 21%
8113 AIG-24-GVL AIGFNTAAAELSGANVPGPILAARVIGGVL 47 5 11%
8114 VLD-26-NLL VLDEADRMLDMGFIHDIRKVLAKLPAKRQNLL 30 16 53%
8115 AKL-27-LDA AKLLSERPVGDIDRERGLLERLIPLGKAHHLDA 35 6 17%
8116 GVI-28-VLV GVIADFFVTEKMLQHFIKQVHSNSFMRPSPRVLV 36 18 50%
8117 GAI-25-LNA GAIALHSGNIAEMQTGEGKTLTATMPLYLNA 29 11 38%
8118 AIE-25-ILA AIEELGGDGLYLLLDKIGVLLIGKTAKPILA 35 4 11%
8119 LDA-24-RIL LDATTVLSREIAEKGIYPAVDPLDSTSRIL 31 14 45%
8120 ILD-26-AVL ILDEPTRGIDVGAKAELYNLANPLGMVGEAVL 36 10 28%
8121 DIL-29-DLV DILRRLGCEVTEGKDLWQAVAPSWRFDMEIEEDLV 30 10 33%
8122 ISG-24-GAS ISGADVRLQGEVIVAASMAANGLAGLLGAS 33 7 21%
8123 GEI-28-ILL GEIVGIAGLNGSGKSTLLRAIAGLLKVSAGSILL 30 19 63%
8124 FLA-28-LAI FLAIGMLAGVDGLGGIAFDNYPFAYMVSNLALAI 37 9 24%
8125 GAS-27-SLG GASPWVVFRTVTLPLLLPGILAGAALAFARSLG 37 13 35%
8126 EVI-29-LEL EVIVKELEEDKLRLVMVFADREFAVNEVIRYLLEL 31 13 42%
8127 GFL-25-PLL GFLLFLLLTSNPFLRTLPDFPIEGRDLNPLL 34 14 41%
8128 DVI-27-SLG DVIVTDNLFGDGLSDVAAMLTGSLGMLPSASLG 27 7 26%
8129 DVI-26-IVA DVIDAATVCLFLQGIEEVVKLISLFPVEIIVA 30 8 27%
8130 GLF-26-LFG GLFNTGRDLALLGRFYAAALVDSGIEFDLLFG 35 17 49%
8131 YGL-25-LAL YGLAELYRDAIKEANLIALPGCYPTAAQLAL 41 15 37%
8132 ALK-28-IVG ALKGAGLIGFTIISLTFSLIAVLGPLLFMGDIVG 37 8 22%
8133 LAI-29-GID LAICAGLTGGRLAFLNRIELAIFMYLLALFEDGID 33 9 27%
8134 LEL-24-IAD LELMKELQQEEGMSVLFITHDGGVVAKIAD 35 10 29%
8135 GVI-29-LEL GVICDMFEGHAPFKPRYVLPDYARFLANGSESLEL 32 9 28%
8136 LGF-26-NLL LGFVRDAIVARIFGAGMATDAFFVAFKLPNLL 29 14 48%
8137 IEL-27-VVL IELAQQSGDLDAESQAVLLRQIAVIEAAHNVVL 30 6 20%
8138 LGT-29-GLI LGTLSAFHGGKLLIRIVRIFSYLIISVPTFILGLI 32 8 25%
8139 GFL-25-GVV GFLGLWAYVAHAEVRIVILLGVAAGRPIGVV 31 7 23%
8140 VFL-25-TGL VFLGGNQLPVRFPEHPHPLFVVAESGFGTGL 27 11 41%
8141 SLL-28-FLG SLLVGLLIAFVIIISVLALLGEAVASKDFLLFLG 40 4 10%
8142 ILL-28-DIL ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDIL 37 14 38%
8143 GLV-25-IVA GLVAGDLALGASNGRNGEALLAYLGRHLIVA 44 7 16%
8144 GLV-26-TGL GLVTALAVFLARLALRAILALLLLLLLAATGL 42 5 12%
8145 VSL-26-LVV VSLNGFLALAGGILDAWEVASLALAGLAILVV 40 11 28%
8146 VIG-29-LIV VIGDSLLVIFIVIGYLPVKINHLGDWGKQFGLLIV 35 9 26%
8147 LIV-28-ILL LIVADPLAGKTALLKEIALLILINAPLAILIILL 48 9 19%
8148 GIL-26-DLL GILAGCDGEAEGGGQDYGLYLSTAFQLIDDLL 33 6 18%
8149 DVL-24-GLV DVLIILLSGGATAVDGAAHGTLAAFAEGLV 43 6 14%
8150 AIV-27-PLL AIVKCKPTSAGRRGVVKIVNAELHKGKPYAPLL 35 10 29%
8151 AIG-24-VLI AIGVLLGGGLALGLVLLSLLVVPLLILVLI 38 6 16%
8152 AFL-27-IAL AFLHRFAAAGAAIRYQAIHSDEVEDILALDIAL 44 7 16%
8153 IAL-24-LLF IALVVLLFTLSELHNSIRIIALAIFELLLF 50 6 12%
8154 LGI-28-GVI LGINTDHVILLTFVIGAALAAVAGVLLGQFVGVI 44 11 25%
8155 TLL-25-LID TLLDAGIFFPAFYFGLAEGAIVGGLEGFLID 39 8 21%
8156 ILA-25-LIE ILAADSGERLKPDTKATPKELLVVGGEPLIE 35 8 23%
8157 AIA-29-TLI AIATSLIADAVGVGLAFSQVAIIATAAAIGLATLI 45 6 13%
8158 LLT-26-LEL LLTYPKLLAADILLLQPDLVPVGADQKQHLEL 41 8 20%
8159 GLG-28-FLL GLGGALAGFLALSGNMLSLLALAALLGGALLFLL 41 3 7%
8160 LSA-28-VVS LSALEEIELAQRIEVGDEAAERRLAEKNLRVVVS 38 12 32%
8161 ASL-27-IGS ASLFFRPVGFDYRSKIEVTRWRGMWDWGLFIGS 32 6 19%
8162 GVL-28-ILA GVLFIAASHGAGGGAQSALAAAAMGGMIAALILA 51 7 14%
8163 AGI-25-ILL AGIATGMVLILGTATLAALIGAGGLGSLILL 50 7 14%
8164 GAL-24-LIE GALKLKEISYIHAEGFAGGELKHGTIALIE 37 17 46%
8165 LID-24-AFL LIDGGPWLKVKNPNTGKEIALKDVIADAFL 28 8 29%
8166 LPL-29-IDL LPLLGLDEASRAARLAEPVLHARTLQPVSGLAIDL 31 7 23%
8167 EIL-29-NLL EILVLDEADRMLDMGFIHDIRRVLAKLPAKRQNLL 32 11 34%
8168 ELV-25-LEL ELVKITKPEDSKEALEKLTGHAEEVLQLLEL 41 19 46%
8169 LLP-27-ALI LLPLLGLALFIGGATPALTTVLFVKVARVIALI 47 12 26%
8170 IVG-27-GLG IVGIGLAALAAGGAGLFVYAAVNGYAIILLGLG 37 1 3%
8171 ATL-28-VIA ATLHVGALLADCGEIAVLKGDPTDTEAFALPVIA 48 8 17%
8172 GVG-28-LDI GVGKTAIAEGLAWRIVQGDVPEVLADCTIYSLDI 28 23 82%
8173 ILD-24-ALL ILDVESDTATLGKRQGADAALGKSTYPALL 44 15 34%
8174 VSG-28-LDA VSGTIFSDRAFTLLADEQLGLGRLAQADEAVLDA 39 8 21%
8175 VVS-25-GDL VVSHDRHLLRSTTDDLLLVHDGKVEPFDGDL 28 12 43%
8176 SGV-27-LVL SGVGIGSALLVSLIAIGFIGAVSAAMLTLILVL 38 7 18%
8177 GID-27-LDV GIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDV 25 17 68%
8178 ITA-25-VVI ITAGFDLRLDEFETVGNTIRAFASDNATVVI 30 14 47%
8179 LDG-24-LAT LDGIGPEDIGLDLLEQRLAEEAISEVILAT 35 13 37%
8180 DVI-28-GLV DVIESAASATGKAHVIKSHHNVGGLPKEMKMGLV 30 15 50%
8181 SLL-24-GKL SLLDRGVPEAAAHIRGGSLFGGLLYTLGKL 38 16 42%
8182 LLV-28-IVD LLVGNETRDDAAVYDLGNGTSIISTTDFFMPIVD 32 10 31%
8183 ALS-26-LLF ALSSTAIALQALNERALLVTQHGRSAFAVLLF 42 23 55%
8184 AVL-27-VID AVLMVESEAKELAEEIMLLAVMFGGKGFQLVID 34 7 21%
8185 SLG-29-GLI SLGSDTGGSIRQPAAFNGVVGLKPTYGLVSRFGLI 45 12 27%
8186 VSL-29-VGL VSLPALREKFAFPVVGAVPAIKAALRGTANGKVGL 41 7 17%
8187 IVL-29-ILV IVLAFAGDTAFSNSLNWRAMLGVLAIPAALLIILV 38 6 16%
8188 VGL-24-GLS VGLFGGAGVGKTGNMMELINIIAAAHAGLS 43 8 19%
8189 GIG-29-NLA GIGPAYMDKAARVGIRIADLLDKDIFAERLGINLA 32 11 34%
8190 KLA-28-GDL KLAPALAAGNCVVLKPAEQTPLSILVLLELIGDL 31 16 52%
8191 GIL-27-GVL GILDPEDARDAVRFGADGIVVSNHGGRQLDGVL 39 14 36%
8192 LID-26-IPL LIDTLISGEYGAFIDAVAHMILPAIVLGTIPL 27 14 52%
8193 LPL-24-GVI LPLLIGYTGGKLVGGERGGVVGAITTMGVI 35 15 43%
8194 EIL-28-RIL EILADEAWAELGEIPKEDVAKIREKADFDIDRIL 32 11 34%
8195 SLV-26-RLL SLVADFHRNLLKGGIYLYPSTASHPAGKLRLL 42 12 29%
8196 GSG-29-NLA GSGALGLEALSRGAAGATLVEFDGAVSQQLKKNLA 29 11 38%
8197 IGA-24-LGT IGAGLVGVMYVLDEPSIGLHQRDNERLLGT 37 12 32%
8198 PLL-27-LLE PLLALELLQLLAEGLRLVQLGALIAERRAWLLE 43 6 14%
8199 TLI-25-AVL TLIKGILGSFPVLSIIVLTQNNGAAITIAVL 45 12 27%
8200 SGV-26-GAS SGVRLELLELLLAMLNKGIVPVIPEQGSVGAS 32 20 63%
8201 LDV-25-RLL LDVPFRIADAGGLTEAGYVGEDVENIVLRLL 40 10 25%
8202 ITA-29-DAI ITATQMLDSMQRNPRPTRAEASDVANAIFDGTDAI 26 14 54%
8203 SVV-27-LLT SVVATVAGLISFDLFAIAPRAELAVPQVQYLLT 33 5 15%
8204 AIT-27-YGL AITLGTVALGPVISQMLVLSGIALVGTAGVYGL 22 14 64%
8205 LVF-26-AIA LVFAEAEDIISGGNFHAEPVAMAADNLALAIA 33 8 24%
8206 LGL-25-IEL LGLNDELAHSRIARSSGRLDLELEIDYQIEL 39 8 21%
8207 LSG-27-ALE LSGGPLLGKAILVIAAAELAPRMQDLTIAVALE 48 8 17%
8208 LGV-28-LGS LGVTALLLGTLLLVGLEGLMQAGAITMITVRLGS 41 6 15%
8209 LAI-26-VGK LAILSSGDVGQVAAAIENEDIKFLTKFPGVGK 27 17 63%
8210 VIA-28-NLL VIAVALALEPYLFDNDEPTSALDVSGQARITNLL 33 16 48%
8211 VSL-27-ATL VSLVGYTNAGKSTLFNRITEARVYAADQLFATL 42 15 36%
8212 VGL-29-LLN VGLGLGRPVSVAPIIPHEMHAEVYPDGQETAALLN 38 7 18%
8213 LTG-26-GIV LTGREGGWRKGKGGSLHMFSKIILFYAGSGIV 34 7 21%
8214 EIA-26-ALT EIATGFGRTGKLFACEHAGIAPDILCLGKALT 35 24 69%
8215 GAG-28-IAT GAGGMRFYHPEYLRGVRALCDEHGILLIADEIAT 36 23 64%
8216 GSG-25-IGV GSGAIKAAVMALLSDLPRKQSRTKSNAFIGV 30 11 37%
8217 IVA-26-ALI IVAILGALDAGIISEADAGLVGDIYKVLPALI 51 11 22%
8218 LLP-26-AIE LLPLDLEDFVPENHIARVLNDIVDVVDITAIE 30 11 37%
8219 GEL-25-ILG GELTALLSAIKLGAKIIHLAINKAGLVAILG 31 8 26%
8220 GGI-24-SLL GGILAALFIVQVFQLILGGFGFSGQIGSLL 39 6 15%
8221 GIS-28-IGA GISGLVGGAGIANIMLASVIEKTLEIGLGKAIGA 32 6 19%
8222 ASG-25-ATL ASGSRGLIDAALAVLAIQAAIVAEIGAPATL 44 6 14%
8223 VVS-25-DVL VVSAMGVLTDELLRLALAVVARPAARELDVL 32 8 25%
8224 SIA-27-ALG SIAFGARANAAGAVAEALGGLSAAALIGAIALG 45 4 9%
8225 ELL-26-GIT ELLKQSGTLDERKELAERAMDSNDIEKERGIT 31 17 55%
8226 GLS-25-LLI GLSGLITPSLDEMVHVAKEMERQGFDIPLLI 44 22 50%
8227 AVL-25-EAI AVLVDTEGCLNAAGLICLVAEREAPAIAEAI 48 9 19%
8228 IGL-27-LVI IGLTFALLALIEFTLLSVSIIAALQTVGAKLVI 42 5 12%
8229 VLV-24-FGL VLVCTTIIETGIDVPNANTIIIERADRFGL 35 23 66%
8230 EVL-25-LLK EVLDELKDEEEAGELAVEIGTTGAGKATLLK 42 1 2%
8231 GVL-24-EVI GVLFPPKGYLERLRNICDRHGILLIFDEVI 30 10 33%
8232 VIA-28-LAI VIAQLLFLDGLGKTKDIALYSNSPGGGVEAGLAI 52 18 35%
8233 LEA-25-GIA LEAEALVRALTEELIAIGEDTELRFLVLGIA 37 4 11%
8234 LIE-24-RLI LIEFIGDSLATRINLILKDEKDTTARLRLI 32 7 22%
8235 RLL-29-VDL RLLAVGLNSETGIHATLNPLCADCREVDEASMVDL 41 15 37%
8236 VLI-26-GID VLIVEALAQVGAVAILNKEENKGKEALFAGID 30 16 53%
8237 LIV-27-LGG LIVDNTVATPALLAPLTLGADIVVHSATKYLGG 41 10 24%
8238 EIA-29-LLE EIAEEAKESGGLVLLLDEIHGLDKTKQDFLLPLLE 44 7 16%
8239 GAG-24-IVA GAGIGKEEALALLLALAVYAPAALAEAIVA 41 6 15%
8240 IVA-28-DAL IVALDAEGPVTDAAGGIAEMAGLPPEVRAVADAL 38 8 21%
8241 ELG-27-LSL ELGTLSFKVGDEVENLSLGGILLATALLELLSL 40 4 10%
8242 LVI-26-LLT LVIGGGFAILGGSIAARAEGKKAKALGGTLLT 43 4 9%
8243 AIE-26-EVI AIEVLQGLEPVRRRPGMYTDTTRPNHLGQEVI 29 13 45%
8244 GIS-24-LLK GISKRGNKYLRSLFYFLAETQYSRNPTLLK 34 12 35%
8245 ASG-29-GLV ASGILAAADLITSNFAALLAAAAFGLVLALVSGLV 46 5 11%
8246 ISG-29-IAV ISGGQDSTLAGKLAQMAINELREETGDGAYQFIAV 35 18 51%
8247 RIL-27-ELA RILADAPCSATGVIRRHPDIKWLRRDADIAELA 38 8 21%
8248 IVS-24-GIS IVSEADMRSPEEAYAYLTALKEIIQYTGIS 28 14 50%
8249 VSV-29-LLV VSVLRLLGLLALAAAILAAALAVIAKLAALLGLLV 36 2 6%
8250 GDL-24-SLV GDLLARATLDVDRVEFAAGEGVHTAVDSLV 29 8 28%
8251 GIT-28-IGG GITAEAMTGALAAGRRKMDTFGVIIIATATAIGG 29 14 48%
8252 GIT-27-LDA GITEWIHHWKALGTATADKKVLKNDDLWQFLDA 31 8 26%
8253 GLL-27-TIA GLLAGMNREELEGVIGHEISHIRNYDIRISTIA 41 12 29%
8254 LVL-28-LNA LVLGAVIPGSSLLAVCSSPAKIDQLRSDVLTLNA 37 7 19%
8255 LLK-29-LLR LLKKATVLKNVTVIDLIADYPPFFADRPRGLALLR 39 6 15%
8256 LLK-27-RLI LLKDASADLLLEAVRVVAAGEALLAPSITRRLI 32 12 38%
8257 LAK-27-VLA LAKGNTGQQVGDAAIKHGGFYLGSIGGPAAVLA 48 13 27%
8258 LVV-26-LLP LVVEAGFMRILGELFLARFLGRLKNIHPALLP 46 13 28%
8259 GIL-27-LPL GILVREFAIGMGPKIFFHIGKAGAAYTLRILPL 39 9 23%
8260 AIV-29-IAG AIVEGLAQRIVNGEVPEGLKDKRLLSLDLGALIAG 42 30 71%
8261 GSG-28-LLR GSGPAGLAAAQQLTRAGHLVAVFERDDRGGGLLR 39 16 41%
8262 GSL-27-RLL GSLVADFHRNLLKGGIYLYPSTALEPDGKLRLL 40 12 30%
8263 GSL-28-EVI GSLADVSAPDLGAAAIKAALERAKIDAELVDEVI 27 13 48%
8264 GID-24-IGL GIDALVVIGGDGSYMGAKRLTEMGFPGIGL 30 9 30%
8265 GID-28-VVI GIDLLIFELQAASAIRKFIRIILHLQAIGLAVVI 27 6 22%
8266 IAD-28-SAL IADSDKLRVGDFAVAGGNPFGLGQTVTSGIESAL 34 13 38%
8267 GLF-26-LIG GLFAGSGVGKSVLLGMMARYTRADVIVVGLIG 40 20 50%
8268 YGL-25-LNA YGLPTLVTNCSNNYGPYHFPEKLIPLVILNA 23 19 83%
8269 LIA-26-ELV LIATGLNALVWIVLGVAEYWFRLGEAAFLELV 39 10 26%
8270 EAL-28-IAG EALEELAESIQAAGIINAIHVRGLGAERRAIIAG 45 9 20%
8271 IAL-28-GLD IALFCNVPEKAVISLKDVDSIYKIPLLLKSQGLD 40 21 53%
8272 LIG-27-LLK LIGTSRFGLKAFTDELDLYILDSDIKLFLALLK 44 6 14%
8273 ILL-27-VIG ILLGLAGKLAAGIQILPLPALAGVSLLLGLVIG 43 10 23%
8274 LAS-26-NAL LASLVVPLLAGNKETADQQKAIGDIVALENAL 35 7 20%
8275 VLG-29-LLN VLGGVSLDGGSGKISEVVIGILILGTVENAKNLLN 36 11 31%
8276 SLG-28-TLL SLGRTLALGLIAGKVAGLLLSALSMLLGGVITLL 45 8 18%
8277 VGL-27-VLT VGLLMLSNVAKLDFADFVDAMAGLVCAVFIVLT 37 13 35%
8278 GIA-26-GIS GIASLRAPCVWIPGNHDFQQAMYSALQDAGIS 34 6 18%
8279 LID-24-IAL LIDFKRNKDGIEAVVKTIEYDPNRIANIAL 39 10 26%
8280 TLA-25-SGL TLASSSLEDAAAPLVAHIRRGVVDAIVLSGL 44 9 20%
8281 TGL-29-AAI TGLGVLLMATLFPVMVNEGISRNAAAAACASPAAI 45 10 22%
8282 DIL-26-GLL DILMLYGDAPLISQITLQRLVDAKGAGGVGLL 34 7 21%
8283 VDL-25-LGL VDLAVGRGETVALVGESGSGKSTIIMAPLGL 40 13 33%
8284 IAD-27-SLL IADEPTTALDVKVQAQILALLKGLQADLGMSLL 34 14 41%
8285 GLF-28-LLG GLFQLPNNATIISSAPRERSGGASGMLGTARLLG 47 11 23%
8286 LTL-29-NLA LTLEYKGDALAVAAPAQLDLDVAGVNVLAVATNLA 33 3 9%
8287 VGL-27-LDG VGLLGPNGAGKTTLFYMIVGLVEPDAGAVELDG 32 19 59%
8288 GSL-25-IVG GSLLLGPSAASLFAIAQDVAMSVVLVGFIVG 33 6 18%
8289 LLN-24-LAT LLNRRAQALDPTALTIRDLDFQGEMVKLAT 34 10 29%
8290 VIV-29-SIA VIVSEAGASVYSASELAAQEFPDLDVSLRGAVSIA 28 22 79%
8291 LFG-28-FLG LFGREAPVTLEIGFGMGASLVAMAKLRPEIAFLG 31 7 23%
8292 VGI-25-GSG VGILASRIKERFHRPVIAFAPAGDGTLKGSG 29 9 31%
8293 GGS-28-DIL GGSAKQGRDRKFQAILPLRGKVINTEKAKMVDIL 27 10 37%
8294 VIG-28-LGF VIGVTEGFTKKLQLVGVGYRAALKGNVANLSLGF 32 10 31%
8295 VIG-25-LEV VIGRGGAEADRIRGALEKLTGKQVQLNILEV 28 10 36%
8296 IEA-26-TLI IEAARSLGMTGVQVYRRIIIPNAAVVATPTLI 28 8 29%
8297 LFG-25-GLD LFGKKVLDVGCGGGILAESMAREGATVTGLD 29 9 31%
8298 GFL-29-VIG GFLRFGTIGGWSVLVLGLQTAIVVGNKGFVGGVIG 31 5 16%
8299 LLV-24-EVL LLVPDLILGLHEIKSGLAIPVVLPSVFEVL 45 5 11%
8300 SGL-25-ELG SGLFTEGGDGNYSVDKEIEGNSHDSISKELG 38 6 16%
8301 GIL-24-SLL GILFALMMALLAVYAVLFAGWSSNNKISLL 51 9 18%
8303 GSL-26-ELG GSLSREARIEAERKLKAGALKALVCTSSLELG 34 16 47%
8304 IVG-29-VLI IVGIVSLLPGATLSMPGIAGIVLTLAVAVDANVLI 34 8 24%
8305 VLT-29-VLA VLTLTAVAVLLIEVLLAIVGAAMITRVPAVATVLA 46 6 13%
8306 ADL-29-GVS ADLNAFAAGDKARAAEAAGRFGEAFEALSAFRGVS 35 7 20%
8307 GIS-29-ALL GISASKAALIAALRSSLAIVVLRLGIEAGVLVALL 52 3 6%
8308 AFL-25-VAL AFLDVALDLAQAAAVLVLLSAKTLAALVVAL 44 5 11%
8309 LSL-29-ITL LSLNGVLAGLQSVFIPSLSLFMLTRLIGGNRVITL 41 8 20%
8310 LIA-26-GSI LIAGNIATAEGARALYDAGVDVVKVGIGPGSI 34 13 38%
8311 ILL-24-IAD ILLIGPTGSGKTLLAQTLARLLNVPFAIAD 32 22 69%
8312 ASL-27-NLL ASLRRQGLRAKASRKFSPVSYRAHGLPVSENLL 36 13 36%
8313 GLV-25-FLL GLVVGAVGDKFGLAAVIAVEILAAAAGAFLL 37 9 24%
8314 LVE-26-GIV LVEQTNAALLNENANKDSKVIPTQRDLLAGIV 33 8 24%
8315 LVV-28-LGG LVVGGGGTGLAAAAIAASAGAKTVLVVEAAELGG 46 18 39%
8316 DVL-26-IPL DVLLVPAASEVLPKDVSLKTRLTRKIELNIPL 27 15 56%
8317 LLN-25-LLD LLNLDGIEYTLIKAAAGKANIILILKEELLD 43 7 16%
8318 ALT-25-SLA ALTLATLPALLGVGLARALRVLLALLAASLA 56 4 7%
8319 LLF-28-LIV LLFFTKVQGDGLAASLAADGRIANGANDLDLLIV 38 6 16%
8320 IAV-27-VLE IAVHPENDPEGGGNAIAKAWAAATGGHRAGVLE 32 11 34%
8321 EGL-28-VSG EGLGNKFLSHIRQVLAIFWVVRCFVNFNIGHVSG 30 11 37%
8322 DIL-24-GIG DILALLRLVPLISDETAFRRIDAKPKGGIG 30 10 33%
8323 VGI-28-FLL VGITLAQEEAVFTLCKEARQYGELVRPEPSRFLL 28 6 21%
8324 DAI-27-ITA DAIVKAAKAKGAYSFAIARGIDANQGGNGEITA 24 6 25%
8325 RLI-25-IAV RLIEERDKGKAVLAVSFELDEILNVSDRIAV 28 13 46%
8326 TIA-25-LVV TIAALYLRLLGGLAASAAFDRGLIVPEGLVV 34 8 24%
8327 FLG-29-ELG FLGLTVGVNLNGLSDEEKREAYACDITYSTNNELG 28 20 71%
8328 LIG-28-DLL LIGRLTGNNLINLGLYQDVLDALKAADINLTDLL 38 9 24%
8329 LEA-28-ASG LEAGVRYLAGALGPEGIRVNAISAGPIRTLAASG 45 20 44%
8330 LVV-28-VIG LVVPLAVIGALLATWLRGLENDVYFKGGLLTVIG 40 9 23%
8331 IAG-27-LVV IAGLALGGKVAEGDNGLAFLDIEQGTKGAGLVV 40 4 10%
8332 GGG-29-GIS GGGASVMVALLLGNTGLESIGELALLGAGVGAGIS 31 5 16%
8333 EIA-29-AKL EIAQSVALQPITEIVEKLGDDEDDLELYGKYKAKL 33 12 36%
8334 SLV-26-IAS SLVHVALKLLLEFLLVLALAAGGFRDITLIAS 31 6 19%
8335 VIL-28-AIA VILAFIAIFLAWVYLTESAGTRAARASGDVVAIA 39 6 15%
8336 IGA-29-GLS IGALLLILKLIAALAQAGIAAIVIASELRVVLGLS 44 5 11%
8337 ELI-25-IVG ELISRCLAESGTVTLRKRRLPLEMMVWCIVG 28 19 68%
8338 ELI-25-VIV ELIAASELGFDMIKLAAITREVIRKVIYVIV 28 9 32%
8339 PLL-27-AIL PLLVESGALVDVSAGANPGAVAGGLPQLRLAIL 47 7 15%
8340 NLL-27-LVV NLLLLDEPTNHLDLDMRQALTEALIDFEGALVV 33 8 24%
8341 AKL-25-EVL AKLVAARARLMEALPAGGAEVASEAGEEEVL 35 6 17%
8342 GAI-24-FLG GAIYQAKFLKYLEHRGIKDTLKSTVYAFLG 32 8 25%
8343 GGI-26-LPL GGICYLSEIVEARKDAAVVLGPLTDDLRILPL 34 6 18%
8344 EGL-26-AIE EGLALATDLAAAVGLIAAGAAYTLGQALAAIE 33 9 27%
8345 LGF-29-LLV LGFILAGYGCTTCIGNSGPLLPEVEEAILAADLLV 47 9 19%
8346 GLD-26-LLE GLDFFDALDNRIAAWVIGTRNMKKALLRALLE 41 10 24%
8347 LFG-24-LVA LFGQISLASTEAAIGVGLIIGLLGADKLVA 44 6 14%
8348 IVV-26-VIG IVVVGGGQKGLVGVNEAGLLTGNALAHAGVIG 31 5 16%
8349 GID-24-GAL GIDAAVLAKLLEQQRGTIIEMFNMFSGGAL 34 19 56%
8350 FGL-25-GAL FGLLVAVIAIGVAAKRLNLKFMALSTLPGAL 42 6 14%
8351 FLG-28-VAL FLGAFKFYTSYTLKTFDGKRYLERFEDRVVMVAL 41 15 37%
8352 VLF-25-LGI VLFGGMNVLESRDLAMRICEHYVTVTQKLGI 33 13 39%
8353 DIV-27-VAI DIVDDAELLDFPNDGQTAYSAGFQVGLAASVAI 28 5 18%
8354 ALK-26-LLV ALKQNTDWDYLGMGLAMTGVVIGLFVVAPLLV 41 7 17%
8355 AGI-26-GAI AGISAGDGVQASAYLPEELMGKALVDAAIGAI 44 6 14%
8356 LEA-28-AFL LEAEGARQAEILGAEGEKQSQILKAEGERQSAFL 34 8 24%
8357 IVL-29-VDL IVLMGYYFPIYRGGVKEFLAVAKEAGVDGLIIVDL 27 7 26%
8358 VIG-26-GLI VIGFLLNSAVAYDGNALLLQIGGEDLLDFGLI 42 8 19%
8359 GIA-24-IAV GIAYAGLLAGALAEAELALLLPLAGGGIAV 38 1 3%
8360 LTG-27-LLD LTGLNDHVYLKLAREVDAEAFLVKGIADEFLLD 45 6 13%
8361 ELV-28-VLG ELVESIGGGPFKELEAAAGAAAGVAIGKIGRVLG 40 4 10%
8362 GIV-26-SAL GIVLALGDTGAGDTVAIAREVGILLLLLVSAL 38 4 11%
8363 IVG-28-GLA IVGSRNASPLGGELAEDLANELAAAGFTIVSGLA 43 14 33%
8364 PLL-29-LIG PLLAVAGLSMRFGGLLAVNGVNLELGEGEIVALIG 43 17 40%
8365 DLV-25-GIL DLVAELEKEVTAEEVNAAWKLASEGELKGIL 27 7 26%
8366 NAL-29-VAL NALFRQPDLLEMRDLSQEDAREAEAAQWELNYVAL 39 20 51%
8367 DAI-25-LVA DAIYGGEMSAHHYFRDFAYCDSGMIPWLLVA 38 8 21%
8368 GDL-28-LIG GDLTQRISVTRRDELGLLQRFMNEMTTSLRTLIG 31 12 39%
8369 ITA-27-IGG ITAEAMTGALAAGRRKMDTFGVIIIATATAIGG 30 14 47%
8370 LTI-28-LGG LTINLDMVAFMPCNPSVGGPAKGVVVREIDALGG 32 10 31%
8371 SLL-25-GVI SLLVVFLCLAALYESLSIPFSVMLVVPLGVI 39 9 23%
8372 ALS-25-EAI ALSDEELALLLALEKEQLTLSAEKEALAEAI 42 5 12%
8373 ALS-28-AIT ALSLMLGEAGFTAQSIDTTADVSLDKVSAGFAIT 33 8 24%
8374 LAE-27-LFG LAEAAKFGPVTEFKRGCIEILLSLPAVVVGLFG 34 14 41%
8375 ASL-24-ALT ASLASVVGGAYVIAVLLLWFFGIHGALALT 46 6 13%
8376 SLG-27-GVG SLGAIRAQVLARVIALGALPEILTGLRIGLGVG 35 6 17%
8377 IVL-27-ILA IVLGTLGMIQAHGYASVGKLFAHELGDAFLILA 40 12 30%
8378 VIG-26-ALV VIGGTLGLSLLSIIAVTGAAGTSALDLIGALV 48 9 19%
8379 SGL-24-VIG SGLSHGTDVWLGNAQELIKNGIATLSEVIG 34 22 65%
8380 SLV-26-TLL SLVDIAGTTLLLLSSALFVLLFVLIGEWGTLL 40 4 10%
8381 GSL-24-GGI GSLEALKGSLGGLGNDEVKVNIIHGGVGGI 32 14 44%
8382 ELG-27-TLA ELGYVLNAVRTIIRELLGAVPLIGASGSSWTLA 38 8 21%
8383 LLF-24-LAT LLFGLNYHIAVVLVGVLMALYVLFGGMLAT 35 11 31%
8384 LAT-26-LTG LATVCDLAVLPLGAIPGTATVLFEVGIEPLTG 43 9 21%
8385 AIE-27-IGA AIEAVAHGDESTSKVVGRAIGEIKLPPGTAIGA 37 15 41%
8386 GVS-28-AGI GVSIIVLLPSQKAAQMTRQTFWARIKAYAVLAGI 35 6 17%
8387 LGF-26-AIG LGFIGKTAVLAVGVLLEAMDLGFAPHGGLAIG 35 14 40%
8388 VIV-29-GLD VIVVCAKIEEEIAELAAEDKELFLEELGIEASGLD 29 10 34%
8389 SIA-29-LLK SIARALAVEPKLIVCDEITSALDVSVQKSILELLK 34 8 24%
8390 VGI-27-IGS VGITAAEAGIPELSIPKATNQVIYRILIFYIGS 26 8 31%
8391 LDI-29-IGA LDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGA 27 9 33%
8392 LGT-24-AIA LGTPKGKAFGAIALKAFPSGILEGGLLAIA 45 15 33%
8393 LGT-26-VGK LGTALYWIAASINIKPGHDYYFYIRSVNTVGK 24 11 46%
8394 FGL-28-ILL FGLFRLLPFALPQLLVDIVLAPLPGLIKATAILL 41 6 15%
8395 LLS-27-YLL LLSKFNFTAIDIAEEEKMLNNTLLLLYAVLYLL 41 6 15%
8396 LLE-28-GIV LLEQAEQGRDYFAIHAGVLLRYVPMTAKRLTGIV 35 9 26%
8397 LLV-27-EGL LLVEDNSEGVASGIDFFDDFAAVHTVIDGTEGL 40 15 38%
8398 ALS-24-GAS ALSLATLMQQLDPSIPAVAIPTIAAFLGAS 43 5 12%
8399 ALS-28-IAT ALSDAEVIHEEIQGAFYHVKYPGKLTEGFIEIAT 37 12 32%
8400 LVG-28-ILV LVGLKFIPARAAPLGLIANTAPVAFGAPGIAILV 42 15 36%
8401 EVL-24-IPL EVLNNHSGLAISPTLIGSLAVMGGALFIPL 28 6 21%
8402 VVL-24-DVL VVLDSAARDAGGDDLRAALKRALGQGGDVL 38 8 21%
8403 LIE-29-EGL LIEVGGDIEEIIILAALAGLAARDYVEARAVSEGL 31 8 26%
8404 VLI-29-AIV VLILVFRLVIGEQAIDVLGPEKRRRRTTQEKIAIV 38 11 29%
8405 LLR-27-LTL LLRLLIILAGRRLLDEQPADNGAAGAAELVLTL 47 13 28%
8406 ATL-29-VIG ATLSIAGGEIAKDIGLADVGMGYNFSAFLWARVIG 40 7 18%
8407 GVV-24-VGK GVVQDIAAIGEMCRARGIIYHVDATQSVGK 26 7 27%
8408 DLI-29-ITA DLIILDINMPKGDGLDLISCVREIVPGVPVLFITA 29 9 31%
8409 GVG-26-IGG GVGGGIGRDVLAREEPMEVRTEGYAIAGIIGG 42 9 21%
8410 GKL-24-DIL GKLELRGLATTIKAAKKMVEREEAVVWDIL 28 11 39%
8411 AFL-24-LTL AFLAKVSAASLKKLALLLLILIAAGLLLTL 39 7 18%
8412 VVS-26-SIA VVSHMFRPEFINRIDEVVVFHPLGPEHIASIA 27 9 33%
8413 GFL-29-ELL GFLARRRHLQALEQAAEHLQQGKAQLLGAWAGELL 30 9 30%
8414 LGY-27-LLG LGYIGAKTGLSTHLLARFSFGVKGSWLISLLLG 36 8 22%
8415 LSG-26-ASG LSGFDTAAAALVSTGELRLVILAIILALVASG 46 2 4%
8416 ILA-26-ELA ILAIQLAPSAGAEGAGATGKADAREAGAAELA 45 2 4%
8417 DLL-25-LAK DLLRPIDAKPLLEALAKALANVKKAKTLLAK 45 5 11%
8418 DLL-24-ADL DLLALQEKLVAIDNIQKTVAEGYKIKLADL 52 10 19%
8419 LTL-24-LLK LTLKEHKELTAMAYGINLDEASERADPLLK 41 11 27%
8420 IGL-24-IAT IGLSFFSPVEKMPLVEVIVGAGTSAQTIAT 38 8 21%
8421 LVA-28-ALK LVAASAPVLAKLGAAAFGLAVILGVSAALIAALK 43 7 16%
8423 VIG-26-LIE VIGKYHPHGDSAVYEAMVNMSQDWKLRNVLIE 33 12 36%
8424 LIV-25-VLI LIVVELFSVETPKLKLLAQKLKDLALEDVLI 39 10 26%
8425 GIA-24-IGL GIACAAVVWVFAFVNFLGVAGVSRLTGIGL 43 6 14%
8426 SLV-27-IVG SLVADLVSLGLSEGGAIASGFVAGQLLIAGIVG 33 4 12%
8427 LVD-29-LLG LVDLTRYGLGEEPMSQELAALGVDLVSFSGDKLLG 45 11 24%
8428 IAV-28-VAI IAVLVLRAADSVVGVTGEAIALLAAAAVAAVVAI 33 6 18%
8429 VIV-27-LGA VIVTAGLFARRLVVSAAVVALFLAPLVSAALGA 38 7 18%
8430 GLD-28-LVE GLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVE 36 17 47%
8431 LLF-25-DLL LLFKACGLAAANLLIELSFWTEGTFSRLDLL 31 3 10%
8432 IAS-26-VLF IASGDSLSAWRIGDTMWMLGLYGAAIGAAVLF 27 6 22%
8433 DLA-26-ISA DLAVIAVVADLLAKAKKINTSEEVAQVGTISA 31 11 35%
8434 ITL-26-RIL ITLSELDLNLYPRLLKQIGAETSAALKDARIL 26 4 15%
8435 TLG-25-KLA TLGTAACPPYHIAFVIGGTSAETNLKTVKLA 29 15 52%
8436 IAT-24-IVL IATALIDTGSSMDGVAGEEFGGTGAAEIVL 32 8 25%
8437 TIA-27-SGL TIANFIKAYYIANGYGDQQVHIVTRLDRDTSGL 30 8 27%
8438 GLF-26-GLD GLFGKKVLDVGCGGGILAESMAREGLTVTGLD 26 9 35%
8439 LVL-25-VLI LVLLDPRDADIFSLALLPAIKILAQIIGVLI 51 4 8%
8440 LEA-27-VLT LEAAFQRKVYELIEEGVTFGEIGLNARMKEVLT 37 7 19%
8441 VLE-26-ELG VLEGLKKHGVKFVALRCAGFNNVDLDAAKELG 44 10 23%
8442 IAG-24-LSV IAGTGANATNEAIEFSPRLAKSGAAAGLSV 39 10 26%
8443 LSV-28-VLN LSVMGSALGDAFGAIEAFDLPFAAGALFATAVLN 27 12 44%
8444 LIV-28-IGA LIVQLVLAITQGVSFQVAFAIGTGLILLDPLIGA 36 6 17%
8445 AIG-29-EIA AIGRAIVRNPKVFLFDEPLSNLDAALRVATRLEIA 37 18 49%
8446 FLL-28-GGG FLLLLVLPVLAGAVTMDLTDRNFGTSFFEAGGGG 30 13 43%
8447 GVI-26-LDA GVINLPPAGSAVAAGQDHLARNETALEAQLDA 35 5 14%
8448 VLT-27-TGL VLTEAAIMGKRDPLRGLKENVIVGRLIPAGTGL 42 19 45%
8449 GKL-24-IGA GKLPIDLSQLKVDLMSFSAHKIYGPKGIGA 28 14 50%
8450 GIS-29-ATL GISGMAALANLSQIVAHLAGSGEALEDAGIDIATL 33 9 27%
8451 ASG-27-LSV ASGRIFGEAAALIYTAGQSAPALDWSNWNELSV 36 8 22%
8452 GAS-28-GVG GASGVAGGALLLIAVACSLFGISNDLAMQVVGVG 45 10 22%
8453 FGL-26-GGI FGLQAGWLGADILINTDSAEEGEIYMGCAGGI 32 9 28%
8454 IPL-29-LTL IPLLFMGGIVGRLFREFAVTLAVAILISAVVSLTL 36 17 47%
8455 GLF-24-LSA GLFFFGWDRLDKAQHLIVTWLVALGSNLSA 39 13 33%
8456 LGL-29-VGK LGLNGAADAASDGALARLASTALISVINNGLVVGK 32 8 25%
8457 VLA-28-GSI VLAAAGARASKISALEGVTIASKAGDEGKLFGSI 34 8 24%
8458 VLG-29-GLD VLGFTEEEAQEQFGFLLDALKYGAPPHGGIALGLD 35 11 31%
8459 VLV-26-GDL VLVHGGLDTVALNGAPFSVKVSEGQKVAAGDL 38 8 21%
8460 LDL-27-ILL LDLQTIGFPITAIASILHRVSGVITFVAVRILL 37 9 24%
8461 GVL-27-GID GVLIVEALAQVGGVAMLNSEENKGKIALFAGID 29 16 55%
8462 IAA-26-SGV IAARREGIVDAIILTDIVVRATELLLGLKSGV 38 5 13%
8463 GIL-25-GEL GILRYRGYPIEQLAEKSDFLEVCYLLIYGEL 32 17 53%
8464 LPL-24-SLV LPLALTSGTLQAWMLVVNALLTILLVLSLV 50 15 30%
8465 SLV-26-ADL SLVGTVNLDARSLVLAALETLAIVDIGDAADL 36 8 22%
8466 IAS-26-AIS IASFAADGSVSTPFAASSFVTVKGADTGIAIS 30 7 23%
8467 GEL-25-DVL GELFVHRNVANLVIHTDLNCLSQVQYAVDVL 34 11 32%
8468 GGI-25-AAI GGIREIVAKLRKMGIKTVMITGDNALTGAAI 42 9 21%
8469 VEL-24-EAI VELENIIAREAIIEDIVVVGAKDGIRDEAI 36 6 17%
8470 ISA-24-IGS ISAYLGVTEPAMFGINLKYRFPFLAAMIGS 25 18 72%
8471 IEL-29-GVL IELGYREIKQTMQLSRLTLRSKKPELVEQELWGVL 29 19 66%
8472 LFG-27-VIG LFGVTTLDIIRSLTFVAELKGKYPGEVEVPVIG 36 13 36%
8473 VDL-24-LDG VDLTQAEAVMDIIRAKGDKAMIIAVKQLDG 29 8 28%
8474 IAT-29-LGS IATVNEIAFPLNTPVAFKITSNSVMNSFFIPQLGS 30 13 43%
8475 LDG-28-LSV LDGREVTALPPHAIARKGIGRLFQEDSLFYDLSV 32 8 25%
8476 TIA-25-EVL TIAVYDLGGGTFDISIIEIDEVDGEKTFEVL 30 14 47%
8477 FLG-26-LAS FLGLCPFMGVSKKLETAGGMGLATTFVLTLAS 34 11 32%
8478 DVI-26-ASL DVIVTDNLFGDILSDEASMLTGSIGMLPSASL 32 17 53%
8479 LVE-24-DIV LVEKFAYGIKDPIYQKKLIETGHPKRGDIV 28 9 32%
8480 LIE-28-IAV LIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAV 30 15 50%
8481 IVL-24-ILD IVLNLRGGLVAVVVVGSSLGLGAINAFILD 27 6 22%
8482 EIL-24-VEL EILGNLHNLFGDAEAHDVVVFDDGSQEVEL 32 6 19%
8483 DLI-27-LLP DLIVTAAFGQILPELLLAAPKYGCINVHASLLP 35 16 46%
8484 EIV-27-SLL EIVGFLGINIVSLLLEQNNVLIGENARELRSLL 34 7 21%
8485 LDG-26-VLE LDGRSSLARLGLMVHVTAHRIDPGWSGCIVLE 34 14 41%
8486 IGS-26-LTL IGSLLSTTLQPLLHSSGATIALLCVWALGLTL 31 7 23%
8487 GLF-24-LSV GLFGGAGVGKTVNMMELINNIAKAHSGLSV 31 17 55%
8488 IAL-25-LLN IALKGILLLIGKGEFVSLAGIGGCGKATLLN 40 7 18%
8489 LLD-25-ISA LLDLGLPDIDGLELIREIRKFSTAPIIVISA 35 16 46%
8490 LAE-29-SGG LAEHHNMTGIASAATSVLIGYLAAATTTLRLGSGG 47 15 32%
8491 LGA-26-LVF LGAFGVAAIGWKAAGLARGLIATSLQTGDLVF 34 11 32%
8492 GLI-27-GIA GLIATIALIANLILIVGGMSLLPGATLSIPGIA 42 10 24%
8493 EIA-29-LGG EIAYRPARVLMQDFTGVPAVVDLAAMRDAVKRLGG 37 17 46%
8494 IGA-29-LPL IGALAGVSLVTIWSDLAGVYSADPRLVKDACLLPL 39 9 23%
8495 LLN-26-LGV LLNLLLIATGLAERAVELASAGLIVSLSLLGV 40 6 15%
8497 AKL-27-RLL AKLIFLNQEDKQIVLDLMRRWSSCMRFAYKRLL 40 12 30%
8498 GVI-25-AIA GVIALMPGVGLSASWLRGKIARALAIKLAIA 42 9 21%
8499 ATL-29-DLV ATLDPTLRRIDVADVGETVLADTVGFIRHLPHDLV 39 15 38%
8500 GEL-25-ELL GELVTLSEALQQILSNKVLPAPVAQKLAELL 43 14 33%
8501 TGL-29-LLE TGLLSGAGKRPLFRLAQSLALELAAKQLERIGLLE 39 12 31%
8502 VGK-25-EIV VGKAKNLKARVRSYFRGSHDTKTERLVGEIV 24 9 38%
8503 IAL-27-VIV IALTLAGGLDLAQANSLPGQGIIAKREMPAVIV 37 6 16%
8504 ELA-26-IGS ELAALAKTAGAKVLESLVQKRDKYDPATYIGS 33 14 42%
8505 AVL-26-IGS AVLKDGVLQQVATPLLLYDTPANGFVAGFIGS 35 12 34%
8506 LDL-28-VLS LDLGEPLSLITESVFARYISLLKDQREAASKVLS 39 9 23%
8507 LVE-25-SLA LVEKLGKLVATLALGAPDDESSEAGPLSSLA 40 6 15%
8508 VGL-26-AIT VGLSEALAPKLYGGEAVKFYTQADFSALTAIT 32 9 28%
8509 VIG-25-LSA VIGALLATTMRGLANDVYFQVGLLTVIGLSA 39 16 41%
8510 LLP-28-VSG LLPGGTAQDNVFLTPAEAAAAEEVALLRLLDVSG 38 4 11%
8511 GAI-29-GFL GAIATALFASAPMAGVVLETIEGSLAGDAVMAGFL 29 9 31%
8512 LAT-28-ASG LATLLATGQAAGALKGLAASLSGIANDVRALASG 42 7 17%
8513 AIS-24-DLA AISYRVHQGFDHFGVALSAGVQRMVRSDLA 32 14 44%
8514 FGL-24-DLV FGLELPLSAYEQQEMGGSVSRANLRTADLV 30 6 20%
8515 SVV-24-LSG SVVYGFIGAQDQVPFMADCFGSTVFGALSG 36 17 47%
8516 LLG-25-EIV LLGGAGLATAKAASALAAGLAAVLRLLREIV 35 3 9%
8517 DLL-26-VID DLLFSRPLNPERVLEPAFDLDFCMDGRDIVID 31 8 26%
8518 LGV-24-IAT LGVPSRMNIGQVMELHLGMAARNLGIHIAT 36 13 36%
8519 LLK-26-IDL LLKELFEGEGFLVVVALDGEQALDLLDDSIDL 37 9 24%
8520 GLG-26-LLN GLGTSVMEVSLRGIEFALVADELELDFGDLLN 37 8 22%
8521 IGL-29-GAI IGLFEGNEAFASQADQVIKGLGALGAKVNVNGGAI 45 18 40%
8522 VLV-26-VIL VLVIADSGATPPFVASDLLSQAEHGPDSQVIL 40 11 28%
8523 LDL-24-VIV LDLLMPALSGFELIAILKKDPLLVDIPVIV 32 4 13%
8524 EVL-25-ILV EVLAVLDADFVRVKWDNDLELQDRGLAGILV 32 7 22%
8525 VVL-25-SVL VVLSVALAQNSQYTLARTLAGAKGSLELSVL 40 5 13%
8526 LVE-29-ALN LVEIAAQTGAVAVAHGCTGKGNDQVRFEVAIAALN 33 10 30%
8527 RLL-24-IAD RLLDEILELLGGDLTVRASVTEAATGAIAD 35 9 26%
8528 GIL-29-VGI GILRQVVPDIELLHLAYELLWAIPSNDGYLLLVGI 36 11 31%
8529 IGA-24-AIG IGAIIFGLLASLIITYIKENSVIKGDTAIG 45 11 24%
8530 LVD-25-GIS LVDKVIRVTNEEAISTARRLMVEEGILAGIS 28 12 43%
8531 ATL-25-GGG ATLLELTAYAIAGALLAMAQTTSDAVVCGGG 43 13 30%
8532 IAV-29-LDL IAVGAALAGIGLELGGLIDALAGTADALVEEGLDL 32 4 13%
8533 IAV-29-IGG IAVVGAGPAGLAAATVAAERGHKVTLFERGDEIGG 36 12 33%
8534 IGV-28-LLN IGVSYLSYFFRILIDPLVLTNTAVVQLWEFVLLN 30 6 20%
8535 AFL-25-IAA AFLDNLAVEALAIAHLFAESATAALACSIAA 38 6 16%
8536 ISA-26-AIE ISASHNPFYDNGIKFFSADGTKLPDAVEEAIE 28 20 71%
8537 GLD-26-ILA GLDPLGIQSLLCMMMEMKEEGAKILMSTHILA 40 14 35%
8538 ALN-27-VIA ALNLTPILVASAFQDNASGGNCAPLSALVSVIA 33 6 18%
8539 IAD-26-LID IADPSLAAVMLPRSGLGHKHGIVLGNLVGLID 29 9 31%
8540 DLL-28-SVL DLLEERLARLRRIGQAHDIQIALPALAKKLPSVL 35 12 34%
8541 LSA-28-SGG LSAAQRDARVAAVLEEVGLDPATRGRYPHEFSGG 44 13 30%
8542 LAI-27-AKL LAITAGVFISIAFVFYITATTGTGTDPFGAAKL 33 7 21%
8544 VIG-24-VIV VIGIIEVIFGTAIIASLGLKLLFDLANVIV 35 4 11%
8545 GIA-29-GVG GIAEALLQLLASVLPLLGGGRGLGSFVVLRALGVG 36 4 11%
8546 GAG-27-AIL GAGALRLMFITILPNCLAPLIVQATLGFSNAIL 43 19 44%
8547 VIL-26-PLL VILILGGIGILKGAGALFAALDLLTDKLKPLL 38 12 32%
8548 LVI-29-ALT LVIALGAAGAAAILHSWEPGIPIWLGSLVITLALT 38 7 18%
8549 ALT-29-LVV ALTGAREAEGPLDLREALGALLLFVALSIEEALVV 43 5 12%
8550 NLL-29-LIE NLLKNGALGIAVGMATIIPPHNLAEEIDALLALIE 31 7 23%
8551 LVD-26-ILA LVDQAWQQGLTEPDPRVDLSGLDVMRKLVILA 35 10 29%
8552 IEA-26-GLV IEALARQKAYGDLTPVGGFSALVDGGDRIGLV 41 5 12%
8553 IAV-27-LID IAVALNVVFGIAAAWAIAKFEFGGKAELTTLID 31 7 23%
8554 DLV-28-LLN DLVLLVLDASEKLTDQDRRLLELSGFSNRIILLN 29 10 34%
8555 TGL-27-DLL TGLPLKEVPALTDFLSAATHLALLKELSLIDLL 36 2 6%
8556 VSG-25-LGF VSGINAGPNRGDDVIYSGTVAAAMEGRLLGF 30 7 23%
8557 GVS-27-AVL GVSQAMQFIACAAQVAASHLEGPVDLILAGAVL 46 7 15%
8558 NAL-29-VIG NALSTQLEVRVHRNGKIHYQEFERGVPAADLEVIG 28 16 57%
8559 SAI-25-GLL SAIATVDIIGLGLIQMTALAIIIDIHIIGLL 40 6 15%
8560 RLI-28-LGF RLIDEARKLGGHVMVADIESQNARSLHLHESLGF 27 7 26%
8561 EIV-27-LAK EIVPVPVKRRKGDVVVVEDEETRPGTSLEALAK 32 10 31%
8562 LAL-28-YGL LALGLVSLPLLAWIAQLILIIILGEELTSYAYGL 43 5 12%
8563 LGI-28-GDL LGIMAHSALSLGLVVVSLLSNVRVDLMAYLFGDL 33 15 45%
8564 ALI-24-GIE ALIGAWILFIGYSHQGPEVTLITANAEGIE 31 7 23%
8565 AIL-24-GGI AILVANKKGGELADGIVITPSHNPPEDGGI 36 10 28%
8566 LGV-27-LID LGVDIRVDLRQLLQASKLRIAALQMAKVVTLID 37 1 3%
8567 ALK-29-VLL ALKLGAFLDVFQLIEAVVKAADGAAVTGGIETVLL 46 12 26%
8568 VAL-26-VGI VALADALNKLVENGKLKTNPLKGAVAAVSVGI 40 19 48%
8570 VIA-26-LIG VIAGLGLLAILLGAAVGIRAGGDLIAALALIG 43 5 12%
8571 VSL-27-ITL VSLGDGDGGKIPLDGVLEGSAVLVDTTTLSITL 38 5 13%
8572 SGL-24-LDI SGLEMAQNAARLSWKAEKVDARLHHIMLDI 28 9 32%
8573 EIA-26-GLG EIARNPEHAYAYTERGNLVAVISDGTAILGLG 35 13 37%
8574 EIL-24-SGI EILGQSEPGAIAANALVLIESNIALLFSGI 28 1 4%
8575 ELV-27-LVS ELVWVGRVMVLVVALIAIALAANPENRVLGLVS 34 14 41%
8576 GSL-29-IVA GSLVTSLLVRETTELESANYGYKFGQEEETYLIVA 36 8 22%
8577 EAI-27-ILG EAIASVDLAENARKDEVKAQLILAFPLWRGILG 31 6 19%
8578 ILV-25-IVG ILVDEFQDTNNIQYAWIRLLAGDTGKVMIVG 31 14 45%
8579 LVD-28-IAA LVDLAALRGLALNALGELDVLKEAGLVLAEAIAA 38 5 13%
8580 LAT-27-TIA LATLAIIVFGLLDAALFGKILFGHSLRRALTIA 34 6 18%
8581 GKL-25-TGL GKLAGKTLLAEDAQIATLITSPANIDSNTGL 28 5 18%
8582 LDA-25-IGA LDASFSFDGVIGAFALTKDAVIIALGLGIGA 38 13 34%
8583 VVI-25-IAG VVIAGRPNAGKSSLLNALAGREAAIVTDIAG 31 16 52%
8584 DAI-27-GVL DAIAAVVLGGTSLSGGEGTIVGTLIGALIIGVL 31 15 48%
8585 GID-27-VLI GIDERLIEGGVDEEISIGDYVLIGGELAAAVLI 27 7 26%
8586 LGT-25-ALS LGTMQGGYNIGPLIDALDDAKLAPIAAKALS 37 11 30%
8587 ITA-28-ILD ITALQMDIKIDGITPEILEEALAQAKKARFEILD 28 18 64%
8588 VLN-24-LLN VLNDIDKRFAGGSEIHIVGLNGAGKTHLLN 28 7 25%
8589 LLL-28-IGS LLLIGSILFFLLLFIFILVSLLAIVALILAVIGS 44 4 9%
8590 LVL-29-RIL LVLVVHFAILFFALGLLGIVARLCGLSIWIIIRIL 36 9 25%
8591 LGI-28-DLL LGITDLTAKVGELSGGQRRRVQLAQVLIEDADLL 44 18 41%
8592 LIG-29-EIL LIGATSGFILRPFLYGGALLGFLGALLSLILSEIL 34 6 18%
8593 LGG-24-ILG LGGRLDSTNVFFPLVAGITSIGLDHAAILG 42 15 36%
8594 AGI-26-GAS AGIIGYRALPVAAYPEVAAPTIAVVTLYPGAS 38 14 37%
8595 LEA-28-LAK LEAEEESVSLEYDIFLRIRAQVELTILRLQTLAK 43 12 28%
8597 VLE-27-GLL VLENLACCLPALLLILFYGQLLKLLLAYVEGLL 44 10 23%
8598 VLE-29-AKL VLEKAFGSPLITNDGVTIAKEIELEDHFENMGAKL 35 17 49%
8599 VGL-25-IAV VGLIGIQGGALSREALSAAALIVFLVLAIAV 39 4 10%
8600 SGL-29-LEA SGLFAPYWRSDARGAIAGLARYVTKAHLARAVLEA 42 11 26%
8601 LTG-29-PLL LTGFAVAFARGVGEYGSVIFIAVNTPAATEILPLL 39 13 33%
8602 TLA-27-LNA TLAEIFFEVSGLIRDEGGALGALVMAEALRLNA 36 5 14%
8603 LPL-27-SAI LPLYLDQLLLELHGALSMWSGIPVSITFLRSAI 37 12 32%
8604 LLN-28-GIL LLNVALPAIITEFAIAASTGQWLLTGFMLVGGIL 33 7 21%
8605 IVA-28-GKL IVAIGTPPGIGKVGIKRGAGVIDVGVNRDVNGKL 29 16 55%
8606 ELG-29-IGV ELGEDVTLAKRAGLLHDIGKAIDHEVEGSHVEIGV 35 12 34%
8607 GIV-25-TGL GIVTGDGMAMALGHGVPLRDMEFVQYHPTGL 34 12 35%
8608 DLA-28-SIA DLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIA 30 12 40%
8609 GVV-29-DAL GVVLAGVGARRFGLVDKGLAEHAGAPPMALRADAL 43 15 35%
8610 ILD-28-IAG ILDNINLDIEEGDFITLLGPNGAGKSTLLKIIAG 31 21 68%
8611 VSG-27-EGL VSGPLIDDINGKVRLAGYKEGLKKNGLDFKEGL 29 9 31%
8612 GEI-26-LLG GEIGKNTYGVEYQDEIIIIDAGIKFPEDELLG 36 21 58%
8613 SIA-26-VEL SIAASLAVGKSTTARVLQALLSRWPEHRRVEL 27 6 22%
8614 SGV-29-SVV SGVEVILTKLHAGGKFSNKNYEFSGGLHGVGISVV 27 14 52%
8615 GID-27-IEA GIDELLEMILLVAEVEELKANPNRLAVGTVIEA 29 11 38%
8616 LSL-27-LDV LSLGQRMRADIAAALLHNPKVLFLDEPTIGLDV 38 18 47%
8617 ELA-26-LLP ELAAKAGVKIDNARRLGREHETALTLERSLLP 43 10 23%
8618 LAK-24-LLR LAKLALKIDDTGAAALLRATDRKPAEALLR 41 5 12%
8619 VAL-24-EVL VALDAFTGLGKAGLGAEAGLVVNAESTEVL 47 5 11%
8620 VAL-29-IAT VALGVDLAPTTLGGLLAAKGLALASRDAGALHIAT 38 10 26%
8621 LGG-28-LLK LGGTPDVKGQQLNASIIAQTRLISAEEFGKILLK 41 13 32%
8622 LDL-26-LSL LDLPGRALSALPAALAASAAALAELAAAALSL 46 9 20%
8623 IAG-29-VSL IAGFRLREGMAIGAKVTLRGERMYEFLDKLVSVSL 38 18 47%
8624 LVI-25-LLI LVIPGLENLALTGIANSLERAARQRGIALLI 49 7 14%
8625 LGS-26-TLL LGSEAVRRVFTKTAQLWHNATPHPHWCGLTLL 38 17 45%
8626 LDA-29-LIE LDAIAAEILAALDGTLDDFIAARETEGQALKALIE 32 7 22%
8627 GGS-28-GLV GGSAAAVASGGAFLALGSDAGGSLAIPAGAKGLV 41 12 29%
8628 AIT-29-ALG AITGAFLWGSGGGVLIAEGLRLIARTAIRALQALG 37 12 32%
8629 LLI-26-AIE LLIAVPVLFGIALFLTLLAPGWLKLILGIAIE 34 6 18%
8630 VLE-29-IGG VLEKMKLFAQAVISEEWKGYTGKAITGVGNIGIGG 33 10 30%
8631 VLE-26-IGV VLEGGGFRGVATGGVFDADNDFVLPFRYVIGV 27 5 19%
8632 GAG-26-LGY GAGKSTLIKLLAGELAPDSGEIGLAKGVKLGY 34 21 62%
8633 AIG-24-VEL AIGVSNFEAHGLALGRATHMVKPMINQVEL 30 12 40%
8634 GAI-25-DVL GAIFGLTRGVGMNHIIRATLESAAYQTRDVL 31 10 32%
8635 ITL-24-IGG ITLGTRGLFEGSALLLSGLAGATGYEGIGG 31 7 23%
8636 VGI-24-AIV VGIGGDPIPGSNFIDILKLFQEDPQTEAIV 30 18 60%
8637 RIL-29-VLS RILKAADLLIALPAHLAEARLRSELQYGHELKVLS 29 11 38%
8638 IVV-29-GAS IVVGAVGDILGVKIARLTADFTLLARLLIFAPGAS 28 8 29%
8639 VID-24-TGL VIDNGKGIPEAARARLFEPYFTTREIGTGL 29 11 38%
8640 IAL-24-IAD IALILLGAKGHLLLAQTLALVLAVRFAIAD 35 6 17%
8641 LGI-24-VLV LGIPQPLGLTAIGVEEAVALAEKIGIPVLV 46 9 20%
8642 TLL-27-EIA TLLKALSRILKPKEGTVLLDGEAIHKLSTKEIA 40 17 43%
8643 LSG-25-LEL LSGLGAAIGGISRAADIIGQKALQALSNLEL 44 10 23%
8644 GLG-27-VSL GLGLAVEGLGTFANVFVQASSLAVGFDGMAVSL 45 9 20%
8645 SLA-25-AGI SLALAGHAFGASQDIPDSILGVVHRGLGAGI 44 8 18%
8646 LGG-26-GGI LGGQGAPLVPAFHHALLAHPTEIRVVLNIGGI 40 12 30%
8647 LVA-28-LLK LVAHIGSSIPAIVIFKVPTLPAIIDKASLLILLK 43 12 28%
8648 GVL-25-GIA GVLGYTEDDVVSTDFNGEVCTSVFDAKAGIA 54 13 24%
8649 GIA-26-GGI GIAIAAHAMLSTLGIIIAPDVYGPVTDNAGGI 37 10 27%
8650 AIV-29-VIA AIVVVENIFRHIEEGESPLRAAIEGTREVAFAVIA 41 25 61%
8651 GSL-28-LVI GSLSVMSRDDGKARLAELGAKVAISVSLKTDLVI 34 8 24%
8652 LLP-29-LDA LLPKYRGGAPIHRAIIDGETETGATIMYMVEKLDA 41 20 49%
8653 FLL-27-VIG FLLGLLLIAALDPIFEALTDFALAGMGALLVIG 35 5 14%
8654 VVI-27-VIA VVIAGDGQATLGNTVMKGNVKKVRRLYNAKVIA 33 13 39%
8655 VDL-26-GVL VDLTVLLEKLATYEQIKAAVKAAAEGELKGVL 33 14 42%
8656 GGS-24-ALE GGSILTLTYYGSEKVIPNYNVMGVAKAALE 36 15 42%
8657 YGL-24-LGG YGLPKEPVVILYPAAGVSLVQFSGDKLLGG 37 12 32%
8658 LAS-27-LVF LASALGTILGMRLYGDAGVAIATGALTFVVLVF 30 10 33%
8659 LVE-26-SGV LVEAGLDWFPTKIDGVKPVNVEAGRPLAASGV 30 6 20%
8660 KLA-26-LDI KLAEEDPTFRVETDEETGQTIISGMGELHLDI 30 23 77%
8661 LVI-24-LDA LVIDMATFATLAPEELIRKAATILAAQLDA 35 6 17%
8662 VSG-25-LDG VSGITNLSLNSIDVLSGLDTVKICVAYDLDG 32 15 47%
8663 AEI-27-ATL AEIGDKDALLALILAAFFKKASPIIAAIAVATL 35 8 23%
8664 VDL-26-IGG VDLTGAKNVKARRGELIADLAAATIIGIEIGG 30 5 17%
8665 GID-24-VIA GIDAANGITTFNEGYSISGAMATDAGKVIA 29 6 21%
8666 EIV-25-GEI EIVGLVGESGSGKSTLLRAIAGLLKPDSGEI 30 16 53%
8667 LGY-25-ELG LGYLLAGIAIGPWGLGFISDVDAILHFAELG 26 17 65%
8668 GIG-28-EAI GIGVINFAYYLAKNGKRYSDGSANNLTHKTFEAI 31 15 48%
8669 GIL-26-ELG GILNGTSNFILTKMQEEAASTEMLLAAAQELG 30 7 23%
8670 TGL-27-ILD TGLYNRRRRFGTLDDFRDFIDAAHAAGLVVILD 29 7 24%
8671 TGL-28-GEI TGLLVTEVMGQGVVAITGDYSRGAAGFWVENGEI 31 10 32%
8672 TLG-26-LNA TLGLFEKNIAEIAEIVHNAGGLLYYDGANLNA 32 17 53%
8673 IVV-24-LLP IVVAYGAILPKEILSLPKLGCYNLHASLLP 32 11 34%
8674 LVL-25-VIV LVLLALTSPLAEGLALLPLLREAAGATNVIV 40 2 5%
8675 LLV-26-AIS LLVSARGIDILEIAPALRAAFVQPGGAALAIS 41 5 12%
8676 DLL-26-DVL DLLLDHDLLEGEAALFISSDLKGGRVLVGDVL 39 6 15%
8677 ELA-26-GVS ELAVAQREGVLHRNFQGYTTQGECDLLGLGVS 39 15 38%
8678 LIE-26-IAA LIETLKALGAEVRWASCNIFSTQDHAAAAIAA 37 13 35%
8679 VGL-24-GGG VGLARPGDIGADVSHLNLHKTFCIPHGGGG 43 21 49%
8680 GAG-25-FLA GAGVIGLVLGSAGQGDATEGILLKAPAEFLA 35 9 26%
8681 LPL-28-SGG LPLIPVNHMAGHLMAARSVKPLEFPLLALLVSGG 36 14 39%
8682 LVI-29-SAL LVIVAGGGGFLTDREELRLFLDIAITIDADGTSAL 41 11 27%
8683 FLL-27-VLV FLLFGVTGSGKTEVYLTLIALVLALGKEAIVLV 38 9 24%
8684 VAI-27-ILA VAIARALANDPKILIADEPTSALDPKTTAQILA 41 16 39%
8685 AIE-28-LLS AIELFETGDLSKPDAQLTATISKRARPKLLILLS 37 7 19%
8686 ALK-28-IGG ALKADNHHTGDIDSLFLLVHKMLPNGIFPALIGG 30 13 43%
8687 AGI-27-VID AGIKVEDALISPLANAKSKLNEGEGHEGATVID 29 6 21%
8688 VLE-29-LGT VLENQLSISEGASRLSLPEGTLGQWVTAARKGLGT 30 11 37%
8689 GIL-25-EVL GILPDLFREGQGIVAQGELEKGGHVLAKEVL 37 16 43%
8690 GAI-28-ITL GAIVGIAGPAGAGKSLLFRMESGQEQPDSGTITL 29 7 24%
8691 DLV-27-IAV DLVCIKAAADPKSADEALGFAAKAQAMPDIIAV 28 4 14%
8692 IEL-28-LPL IELNQASLDPGGLALNKTLALKSLGIDALEALPL 30 12 40%
8693 LEV-26-VVL LEVKEAIDTLKGAGPEDLKEALLLLGSQMVVL 29 7 24%
8694 LSG-26-SLV LSGKDVARKLVILAREAGYDIELEQVRVESLV 40 15 38%
8695 ALE-25-VLD ALEQNLKPVVVVNKIDRPSARPEAVVDEVLD 39 12 31%
8696 LGV-27-IVG LGVVATGGLTGYPAAAPFGLPLLEGLLIVAIVG 41 16 39%
8697 LSA-24-SVL LSAAFLALFAIGALGGIVRLSLAGALASVL 43 5 12%
8698 VIG-24-LVV VIGHLAGGNLELLHPLLAARDGKRVGYLVV 40 7 18%
8699 IAV-27-LIG IAVALVLGVIGALLVGLPAALLLEAGGLGSLIG 39 2 5%
8700 VVS-29-LSL VVSARARNKLDVGKATLLAVVSALGVLLLGTLLSL 42 7 17%
8701 VDL-28-LLT VDLFNRFLFSAKIIFLVVMLALLAPHIHKVNLLT 34 7 21%
8702 IAL-25-RLI IALIVKVFKIGFHFLLRYLAYIGITAITRLI 32 9 28%
8703 LLI-27-GIT LLILDEPTSGQDASARASALEILGALNADEGIT 31 8 26%
8704 LIG-29-VSV LIGLLLASGATALVLESIILFLLAIAALIAPGVSV 34 3 9%
8705 ALE-29-PLL ALEGDLQLEDIEMELRNTVLEQAPEPERDTDKPLL 44 8 18%
8706 DLL-27-AIT DLLLAISMAGVAREAGLAAAEKLPLGGKVLAIT 26 15 58%
8707 AIL-25-VGK AILSAGSAGQFAAAIENEDISALVKFPGVGK 26 11 42%
8708 LGV-29-DVI LGVDIDNLLVSQPDTGEQALEICDALARSGAVDVI 31 19 61%
8709 LAS-29-VIL LASIIIPFILGNAAIIGDAVIAIGFLSFLALGVIL 38 8 21%
8710 LAI-28-GLD LAIRVAGEIREEKLEIVRELDAILREELAKAGLD 35 8 23%
8711 GLI-27-GAS GLILALTDDGAGALAGPLAPLLIGLAIAIIGAS